(data stored in ACNUC7421 zone)

EMBL: CP001402.PE544

CP001402.PE544       Location/Qualifiers
FT   CDS_pept        complement(485532..486425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0553"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41180"
FT                   /db_xref="GOA:C4KEI3"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI3"
FT                   /protein_id="ACR41180.1"
FT                   /translation="MSQQNTELEGIGKLRSGSLFMILAVLLAAIGVLVIISAGMLGGMF
FT                   SAASGNVSGVIASGIGLLVGIAIVILIGAIIGLIGILRIRSGFGILKSLGRDVGIGEIG
FT                   TTLYLVGLIIIIIGALLTIVLIGFPILILGEIIALIGGILIGIGFYKVGEIYNEGLVKI
FT                   GGILIVIPIDLINFVGFILAYVGLGKVRPLPTVAQQPLVPQVYQVGQGTIRNNGYAYIT
FT                   LYSSTPASIISAKIEGANIMSSAINPTVLQIGNNEVTIFFGNVQSLAPNTTYIITLTIN
FT                   IGGNIINISTTAVYQP"
     atgtcacaac agaatacgga attggaagga ataggaaaat taaggagcgg ctccctcttt        60
     atgatacttg ccgtgttact tgccgcaata ggagttctag taattatatc tgcaggtatg       120
     ctcggtggta tgttttccgc tgcgagcggt aacgttagcg gagtaatcgc cagtggtatt       180
     ggccttttag taggaattgc tatagtaata ctaattggcg ctattatagg gctaataggt       240
     atattgagaa taaggagtgg tttcggtatt ttgaaaagcc taggtagaga tgtaggaata       300
     ggtgaaattg gaactaccct ctatctagtg ggactaatta ttatcattat tggagcattg       360
     cttacaattg tattgatagg attcccaata ttgattttag gagaaataat agcgctgatt       420
     ggtgggatat taattggtat agggttttac aaggttggtg aaatatataa tgagggatta       480
     gttaagattg gtgggatatt aatagtaata cccatagatc ttattaattt cgtcggcttt       540
     attttggcat atgtaggtct aggtaaagta agaccgttac caactgttgc acagcaacct       600
     ttagttcccc aagtttatca agttggtcaa gggactataa ggaataatgg ctatgcttat       660
     attacattat actcatcaac cccagctagc attatatctg cgaaaattga gggtgcgaat       720
     attatgtcaa gtgcaataaa tcctactgta ttgcaaatcg gtaataatga ggtaacaata       780
     ttctttggaa atgttcaatc attagctcca aatactactt atattataac actaacgata       840
     aacattggag ggaatataat taacatatct acaacagccg tttatcagcc ataa             894
//

If you have problems or comments...

PBIL Back to PBIL home page