(data stored in ACNUC7421 zone)

EMBL: CP001402.PE546

CP001402.PE546       Location/Qualifiers
FT   CDS_pept        491770..492456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0557"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41182"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI5"
FT                   /protein_id="ACR41182.1"
FT                   /translation="MSTQVSNPYMQFGNTQPCKHWGFVVKVDQCLGCDACVAACTIENQ
FT                   TPFWRGLFRTHVEDLELGEYPNTQRVFVPRLCMQCENPPCYYVCPTGATQIVVGGIVVV
FT                   DEYKCMGCLYCVEACPYGARYFYTYEDIEKSKEYFGLNSIHVVPHVDKCTFCYGTAPEG
FT                   TYTPACVRTCPGHARVFGCLDDPNSEVSILVNTGQAVVLNPELDVQPKVFYVFNRQLGR
FT                   GGGGNS"
     atgtccacac aagtttcaaa cccatatatg caatttggga atactcaacc ttgtaaacac        60
     tggggattcg tggttaaggt ggaccaatgt ctaggctgtg atgcttgtgt tgctgcgtgc       120
     acaatagaga atcaaacgcc attctggcga ggtctattta gaactcatgt tgaagatcta       180
     gaattaggag aatatcccaa cactcagaga gtcttcgtac ctagattgtg tatgcaatgt       240
     gaaaacccgc catgttatta tgtatgtcca actggagcta cccaaattgt tgtgggaggt       300
     attgtagtgg ttgacgagta taaatgtatg ggatgtcttt actgtgttga ggcatgtcca       360
     tacggtgcta gatacttcta cacttacgag gatattgaga agtccaagga gtattttgga       420
     ttgaattcaa ttcacgtggt tcctcacgta gataaatgta ctttctgcta cgggacagcc       480
     ccagaaggca cttatactcc tgcatgtgta agaacttgtc cgggtcatgc cagagtattt       540
     gggtgtcttg atgatcctaa tagtgaggtt agtatattag ttaatactgg gcaagcagta       600
     gtgttgaatc cggaattaga cgttcaacct aaagtttttt acgtgtttaa taggcagttg       660
     ggtaggggag gaggtggcaa ctcatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page