(data stored in ACNUC7421 zone)

EMBL: CP001402.PE548

CP001402.PE548       Location/Qualifiers
FT   CDS_pept        493755..495122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0559"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41184"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI7"
FT                   /protein_id="ACR41184.1"
FT                   /translation="MTSLFYSPLIKYRVDVLPSSELKKENINTKALVVIGDGIDREKIS
FT                   EDLELNPLLVRIVDKDSSKEEVEYNKVVLENAWLADLAPVEEIKSIDRRSLLRGEVKKA
FT                   KKVDKPIYLSEYCNGLYKACNVCEFSCPYNAIKVDKKTGVNIDYIKCTSCGLCVASCPV
FT                   SAIQFPSLSQNSIFELAKVKGEKRITCYKNTKNRGVKIPCLAMLSEVDIVLLKSSGNLT
FT                   FECPGCEFQDNLKHFIEVIKEYNERIGGISFYSPSEKIEAKETKELNTTPQSFYNRAEA
FT                   RRNISDELPYILFDVSIDNNRCTLCESCVNWCPTSALKLRRDSGVEEIDFDPKRCIGCN
FT                   LCVNVCPESCKLEEGKTSEIPPNIASLTKVIKVEKSKSVNKEVRKLVGDELVRCRVCGA
FT                   PIGSRKSLNHVKKIMIEKGASCEDEWLERCPKHRVEYAFQKQFSFNARFKPRGDLR"
     atgacatccc ttttttattc accccttatt aaataccgag tagatgtttt gccctcatct        60
     gagttgaaaa aggaaaacat taataccaaa gccttagtcg ttataggaga tggaattgat       120
     agggaaaaaa tttcagaaga tctagagtta aaccccttgc tggtaagaat agttgacaag       180
     gatagtagta aggaagaggt agaatacaac aaagtagttc tagaaaacgc ctggctagca       240
     gatttagctc cagttgaaga gataaaatcc attgatagac gaagtctttt acgcggagaa       300
     gtaaaaaagg ctaaaaaggt tgacaagcca atttacctta gtgaatattg taatggctta       360
     tataaggcat gtaatgtatg tgagttttca tgtccttaca acgctattaa agttgataag       420
     aaaactggag taaatattga ttacataaaa tgtacatctt gtggtctatg cgtagcttca       480
     tgcccagtta gtgctataca atttccatca ctttctcaaa attcgatttt tgaattagca       540
     aaggtaaaag gggaaaagag gattacatgc tataaaaata ctaaaaatag aggagtcaag       600
     ataccttgtt tagcaatgct atcggaggta gatatagtat tattgaaaag cagtgggaat       660
     ttaacctttg aatgtccagg atgtgaattt caagataatc taaagcattt cattgaagtg       720
     atcaaggaat ataacgagag aataggagga atcagctttt attccccatc tgaaaaaatt       780
     gaggcaaaag agacaaagga actaaatact actccacagt cattttacaa tagggctgag       840
     gctagaagga acataagtga tgaattgcca tacatattat ttgatgtgag tattgataat       900
     aacagatgta ctttatgtga aagctgcgtt aattggtgcc ccacatcagc actaaagctc       960
     agaagggata gtggagtgga agaaatagac tttgatccca aaagatgtat aggctgtaat      1020
     ttgtgtgtca atgtttgccc agaatcgtgc aaattagaag aaggtaaaac aagtgagatt      1080
     cctccaaata tagcatctct tactaaggtt attaaggtgg aaaagagtaa aagcgttaac      1140
     aaagaggtaa ggaaattagt gggcgatgaa ttagtcagat gtagagtttg tggagcacca      1200
     ataggttcga ggaaaagtct taatcatgtt aagaaaataa tgattgaaaa gggggcttcg      1260
     tgtgaagatg agtggttgga gagatgtcct aagcataggg tagagtacgc gtttcagaaa      1320
     caattttcat ttaatgcaag atttaaacct agaggtgatc taagatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page