(data stored in ACNUC7421 zone)

EMBL: CP001402.PE549

CP001402.PE549       Location/Qualifiers
FT   CDS_pept        495119..495661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0560"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41185"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI8"
FT                   /protein_id="ACR41185.1"
FT                   /translation="MKSLSTDFKIFSFLFLSPRYIKDVKGFVEEIKDKPYYNTLKQIIQ
FT                   LTETNYDKVATEFTSCFINDYKHVKCPPYESWYRERAVYGISAQRVLEEYIEYGIYPKK
FT                   QLADHISTELEFVSFLLFVEQEDEAKKFIKEHIVSWVPKLIEDILVNSKGEYTKLLGIA
FT                   LKQFLDYAIQNIFVVNR"
     atgaagtctc tctctacgga tttcaagatc ttttcctttt tatttctgag ccctagatat        60
     attaaagacg ttaaagggtt tgtggaggag ataaaggata agccatatta caatacatta       120
     aagcaaataa tccaattgac agaaactaac tatgataagg tagctacgga attcacttca       180
     tgttttataa atgattataa acacgttaag tgcccacctt acgaatcgtg gtatagggag       240
     agagcagtgt atggcatttc agcacaaaga gtattagaag agtacatcga atatggaatt       300
     tatccaaaga aacaactagc tgatcacata tctacggaat tggaattcgt atcattcctc       360
     ttgttcgtag aacaagaaga cgaagctaaa aagtttataa aagaacatat agtaagctgg       420
     gttcccaaat taattgagga tattctagta aacagtaaag gggagtatac aaaactttta       480
     ggtatagcgc ttaagcaatt cttagattac gcaatacaaa atatctttgt agtcaataga       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page