(data stored in ACNUC7421 zone)

EMBL: CP001402.PE55

CP001402.PE55        Location/Qualifiers
FT   CDS_pept        45987..46313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH1"
FT                   /protein_id="ACR40691.1"
FT                   /translation="MIIFYAIGERDRAKELVRIITKTRWKTISKHAIKIASSSIGPSVV
FT                   IFKPTMAGLAVALWLKQRAEELGMTSAVGWFQPINQIPPQVEDAIRTDLNKILVKKLEV
FT                   PWSP"
     atgattatat tttatgcaat tggtgaaagg gatagagcaa aagaattggt tagaattata        60
     acaaaaacaa ggtggaagac tatatcaaag cacgccataa agatagcaag ttcctcgatt       120
     ggtccttctg tagttatatt taagccaact atggcaggtt tagctgtggc attatggcta       180
     aaacaacgtg cagaagaatt gggtatgaca tctgcagttg gatggttcca gcctataaat       240
     caaatacctc cacaagttga agatgcgata agaactgatt taaacaagat attggtgaaa       300
     aaattagaag ttccatggtc gccgtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page