(data stored in ACNUC7421 zone)

EMBL: CP001402.PE553

CP001402.PE553       Location/Qualifiers
FT   CDS_pept        498795..499142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41189"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ2"
FT                   /protein_id="ACR41189.1"
FT                   /translation="MPILQAKKRKEHENKREGNKGRRTTRKNHMGSNYIEEKFNVKISY
FT                   SLENSEKEVKNTLQDRQEETNRCRLRERFRGVIKKGVKVFFMDEFGIRHDPSRVYMLLG
FT                   LIIQVLMFSLV"
     atgcctattc tacaagcaaa gaaaaggaag gaacatgaaa ataaacgaga gggaaataaa        60
     ggtagaagaa ctacaaggaa aaaccatatg ggaagcaatt acatagagga gaaattcaac       120
     gtaaaaataa gctacagctt ggagaatagc gagaaagagg ttaaaaatac cctgcaagat       180
     cgacaagaag agaccaacag atgccgactt agggagaggt ttaggggtgt tattaagaag       240
     ggtgtaaaag tgtttttcat ggacgagttt ggtattcgtc atgatccctc tagggtttat       300
     atgttgttag ggctgattat ccaagtgtta atgttctcgc ttgtttga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page