(data stored in ACNUC7421 zone)

EMBL: CP001402.PE555

CP001402.PE555       Location/Qualifiers
FT   CDS_pept        complement(499778..502087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41191"
FT                   /db_xref="GOA:C4KEJ4"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ4"
FT                   /protein_id="ACR41191.1"
FT                   /translation="MPSSSASGLTIQVNVIEDAKALAEYMGVSGMKYELIKVTIINDRN
FT                   SPLLLYPQNFTLIGSDDNTYTEVSVNNQYVSTIKPTSLGSGQSIIGFIAFLIPYGVQPK
FT                   TLEYPGISISLTNVRTLYLSVINVTFMSNDSEVKVLLNGNPSTVLVGVNGQNETLKLQV
FT                   QSYHNSLPVILNKIIVSGNLMLIRYSYLPLVLAPEQSYSVDAEVSFTNSSIYGTAQLEF
FT                   YTSINSTVYSGIVNALVNDTVYAINEGVLGESYLAYNVTVSYGGGSIFILNPSQFVLIT
FT                   NSGNYSAQTVYLPGVPSSSKTVSITSSGKAVETLIFKVPTTSKPLVLEYVSHNGQIAFR
FT                   FNAYTSVTENVLFINHFLGFTNDSKVSVNNIFLGNSITGSYYNSGYYLLSTEKIPVIVY
FT                   ITNNHGQVPVEAQDISIKGPATVFTQNYTGTYILQGQTNVYQIILNMNNISYIGNITIS
FT                   LDTSFGSNLYNISVLDVINASAFGQYLASSGGSQGLTFIVYNISLYYQGPGKFNFNPAN
FT                   FVLVTSQGSYTYYNYVIPNGVANGWFDPGARISDWIPGLPTPFFDRVIPTPGMQSSTLL
FT                   HGYGTHGYLVFGIPTSAIIEKLIYKTSNNLTVFSVNANIKANEYISGVPVVVKVTFNNG
FT                   FGNLTATTNEVVFGVDGYNGYTYYIYGKYMAGNEIGPGGVTGVNVVYPSEPPIKVYTSE
FT                   VKTTYDYYYQIPIQFLQFNQSYWSNSSILNVHIYDIPKNSYMSGGNNLTISIVNLVLQL
FT                   LLVDTIIPIIIYLNLK"
     atgccctcaa gcagtgcatc aggattgacg attcaagtga acgttatcga agatgctaag        60
     gcactggctg agtatatggg tgtaagcgga atgaagtatg aattaataaa ggttacaata       120
     atcaatgacc gaaattcccc attattatta tacccccaaa atttcacctt aataggaagt       180
     gatgataata cttacactga ggtttctgta aataatcaat atgtaagtac tataaaacca       240
     acttcattag gatcagggca atccataata ggctttatag ccttcctaat tccatatggt       300
     gtacagccta agacattaga ataccctggt atatcaatat ctttaactaa cgtaagaacc       360
     ctttatctat cagtaataaa tgttactttc atgagtaatg attcagaagt taaagtatta       420
     ttaaacggaa atcccagcac tgtattagta ggagttaacg gtcaaaacga aacgttaaaa       480
     ttacaagtgc aaagttatca taacagtcta ccagttattt taaataaaat tatagttagt       540
     ggaaatctta tgttaataag atattcatat ttaccattag tattagcacc tgaacaaagt       600
     tacagtgtcg atgcggaagt ttcttttact aattctagca tatatggcac tgctcaatta       660
     gaattttata catcaataaa ttccactgtg tattctggaa tagtaaatgc gttagtaaat       720
     gatactgtat atgccattaa tgaaggagtt ctaggcgaga gctatttagc atataacgta       780
     actgtaagtt atggcggagg aagtatcttc attttaaacc ctagtcaatt cgttctgatc       840
     actaatagtg gtaattattc ggctcaaact gtttatctcc ctggggtacc tagtagtagc       900
     aagactgtta gcataacatc ctctggaaaa gctgttgaaa cgctgatctt taaagtgcct       960
     actactagta aaccgcttgt cctagaatat gtctctcaca acggtcagat agcatttaga      1020
     tttaacgcct atacttctgt aactgaaaat gtacttttca tcaatcattt tctaggtttt      1080
     actaacgatt ctaaagtatc tgtaaacaac atatttttag gcaatagcat aacgggaagc      1140
     tattacaatt ctggatatta tttattatca acagaaaaaa ttccggttat agtatacata      1200
     acaaataatc atggacaagt accagtagag gcacaagata ttagcattaa ggggccggca      1260
     acagtattta ctcagaatta tactggaact tatattttac aaggacaaac taatgtgtat      1320
     caaataatct taaatatgaa taatattagc tacataggta atataactat ttcattagac      1380
     actagttttg gatccaattt atataatata tctgttcttg atgtgataaa cgctagtgca      1440
     tttggccaat acttagctag tagtggagga tcgcaaggac ttacctttat agtatataat      1500
     ataagtttat attaccaagg tccagggaaa tttaatttta accctgctaa ttttgtctta      1560
     gttacttctc aaggctccta tacttactat aattatgtca ttcctaatgg agtagctaac      1620
     ggttggtttg atcctggtgc tagaatatct gattggatac ccggtcttcc tactccgttt      1680
     ttcgatcgtg ttatacccac tcctggaatg caaagctcta cgcttcttca tggatacgga      1740
     actcatggat atttggtgtt tggtatacct acatccgcga taatagaaaa acttatttat      1800
     aaaaccagta ataatcttac tgtattctcg gtaaatgcaa atattaaagc taatgaatac      1860
     atttccggtg tgccagtagt agtaaaggtt acctttaata acggttttgg taatcttaca      1920
     gctacaacaa acgaagtagt ttttggtgta gatggatata atggatatac atattatatc      1980
     tacggcaaat atatggcagg aaatgaaata ggacccggtg gtgttacggg agttaatgtt      2040
     gtatatcctt ccgaaccccc tattaaagtg tatacatctg aagtgaaaac tacttatgat      2100
     tattattacc agattcccat acaattcctt cagtttaatc agagctattg gagcaattcc      2160
     tcaatactta atgtccatat ttatgacatt cctaaaaatt cctatatgtc aggtggaaat      2220
     aacttaacta tatcaatagt gaacctggtt ttacaacttt tattagtaga tactataatt      2280
     ccaatcataa tttatttaaa tttaaaataa                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page