(data stored in ACNUC7421 zone)

EMBL: CP001402.PE559

CP001402.PE559       Location/Qualifiers
FT   CDS_pept        complement(509053..509439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0571"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41195"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ8"
FT                   /protein_id="ACR41195.1"
FT                   /translation="MVDYFVSNIKEVKMDRVLVNGSKNAFIQWLVTKENDSNYAVRKFT
FT                   LLKDGIIPMHIHKYQETVVVTKGKCKVCVSDKVYELKEGDYIFINSNVKHAIINESDQL
FT                   EFFCIIDYPDDMSITTLNEDCNKK"
     atggttgatt attttgtttc aaatatcaag gaagtaaaaa tggatagggt gctagtcaat        60
     ggttctaaaa acgcgttcat tcaatggtta gttactaaag aaaatgattc taactacgct       120
     gtaagaaaat tcaccctatt aaaggatgga attattccaa tgcatatcca caagtaccaa       180
     gaaactgttg ttgtaactaa ggggaaatgt aaggtttgtg tgagcgataa agtttatgag       240
     ttaaaggagg gtgactacat ttttataaac tctaacgtga aacacgcaat tattaatgag       300
     agtgatcaat tggagttctt ctgtataatt gattatccag atgatatgag cataaccacg       360
     ttaaatgagg attgcaataa gaagtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page