(data stored in ACNUC7421 zone)

EMBL: CP001402.PE56

CP001402.PE56        Location/Qualifiers
FT   CDS_pept        complement(46315..48078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0056"
FT                   /product="BPS2 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40692"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH2"
FT                   /protein_id="ACR40692.1"
FT                   /translation="MKVRVFNIGGITQDYSLDLEKGVTSYEAPNAYGKTSLVRALISLL
FT                   TSSIKAEDLLNVFADSGYIEVELDNKLYYRRIKRIKNGLSEDKNLIMDDDRALLLTYFS
FT                   PENKLVTQILSGDGNVEWFISATSKINEIKAKKEELQKLLTAEINARDDLQKKYNNIRE
FT                   IQAKIRAIDEEIDKLEKERESSSNIVAKTTYTITLTRQNKINEIVNKIKVKKDELANLE
FT                   FALKKIEEEIQNKESKVSPDIKTQLQKELEEINEKLKLKTSDRSELEIELKVLERVLEE
FT                   VDESDKHHLDTCNVCGSKVDPSIWKERAEIISRELRDKTSLLDSLRNDIIGLQKRKEEI
FT                   DLRLKEFQTLENEIAKLKAKKEELINRIGSVKFQIDDLERQKRETEERFNKSESLSGAI
FT                   ATSDDSTSILKRIEELRKKREEYEYELQLLGVPSSILEELKEKEEHIEQLQKKVDELQV
FT                   EYIRRLTKAREEFNRISNQLLRKFEFDMEAEIDGNYRLIVRRKGAIIDIKKLSSSERTT
FT                   LALILVLSALRAYFKTPYFIIDESAMTFDQKRFNRLLEYLTEIADYVIVTRSSENTEIK
FT                   TLPPKQIEISS"
     atgaaggtta gagtatttaa tataggtggc ataacgcaag actatagtct tgatttagag        60
     aaaggagtaa catcatatga ggcgccaaat gcttacggta aaacatcact agtaagggca       120
     ttgatatctt tactgacatc cagtattaag gcagaagatc tacttaatgt atttgcagat       180
     agtggttata tagaagtaga attggataac aaactatact atagaaggat aaaaaggata       240
     aagaatggat taagtgaaga caaaaatcta attatggatg acgatagagc attgctactg       300
     acgtatttct ctccagagaa caagttagta acccaaatat tatctggaga cggtaatgta       360
     gagtggttta tatctgctac atcaaaaata aatgaaataa aggcaaaaaa ggaagaatta       420
     cagaaactct taaccgctga gataaatgct agagatgatt tacagaagaa gtataataat       480
     attagagaga tacaagctaa aataagggcg atagacgaag agatagacaa actggagaaa       540
     gaaagagaaa gcagtagtaa tatagtagct aaaaccacat acacaataac actaacaaga       600
     cagaataaaa taaatgaaat agtaaacaaa ataaaagtta agaaagatga attagcaaac       660
     ttagaatttg ccttaaagaa gattgaggaa gagatccaaa acaaggagag taaagtctct       720
     cccgatataa agactcaact tcagaaagag ttagaagaaa taaatgagaa acttaaactg       780
     aaaacctctg atagatctga gttagaaata gaacttaagg tgcttgaacg cgtattagaa       840
     gaagtggacg aaagtgataa acatcattta gatacgtgta acgtctgtgg gagcaaagta       900
     gatcctagta tatggaaaga aagagctgaa ataatatcaa gagaattaag agataagacc       960
     tcacttctag atagcttgcg taacgatata ataggattac agaaaagaaa agaagaaatt      1020
     gaccttagat taaaggagtt tcagacgcta gagaatgaaa tcgcaaaact aaaagctaaa      1080
     aaggaagaat tgatcaacag gataggttca gttaagttcc agatagatga tttggagaga      1140
     cagaagagag agactgaaga gagattcaat aaatccgaat cattatcagg ggcaatagca      1200
     actagtgatg atagtacaag cattttaaag agaatagaag agctaagaaa gaaaagagaa      1260
     gaatatgagt acgaacttca gctattagga gtgccatcct ctatcttaga ggagttgaaa      1320
     gaaaaggagg aacatataga acaattacag aagaaggtag atgaattaca agtagaatat      1380
     ataagaagat taactaaggc aagggaagaa tttaacagaa tatctaacca attattaagg      1440
     aaattcgaat ttgatatgga agctgaaatt gacggtaatt acagattaat tgtaaggaga      1500
     aaaggtgcta taattgatat aaagaagtta tcatcgtcgg agagaactac gctagcttta      1560
     atattggtat taagcgcgtt aagagcttat ttcaaaactc cttacttcat aatcgacgag      1620
     tccgcaatga catttgatca gaaaagattc aatagactat tagaatatct aactgaaatt      1680
     gcagactacg taattgtgac tagaagtagt gaaaacacag aaataaagac actaccacct      1740
     aagcaaatag agatttctag ttaa                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page