(data stored in ACNUC7421 zone)

EMBL: CP001402.PE560

CP001402.PE560       Location/Qualifiers
FT   CDS_pept        complement(509470..509853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41196"
FT                   /db_xref="GOA:C4KEJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ9"
FT                   /protein_id="ACR41196.1"
FT                   /translation="MREIYKYSIFSIIIMFLAFSFGLVRAMYDTVQDTLSTSILILHII
FT                   FAGITGGFGIYLYMLANKTGLLFPKFIGLGNLVSIGIAGFGGLSYLLTDYEWLTKVMLY
FT                   GFEFSLALTSMLVGYLYCFMRHR"
     atgcgagaga tctataaata ttcaattttt agtatcatca taatgttttt ggcattctca        60
     tttgggctag ttagggcaat gtatgatact gttcaagaca ctttgtcaac tagtatcttg       120
     atacttcaca ttatctttgc tggaatcact ggaggttttg gaatttacct ttatatgtta       180
     gctaacaaga ctggtttatt attccccaaa ttcattggtt taggcaattt ggtatccatt       240
     ggaatagctg gatttggtgg tttgagttac ttgttaacag actacgagtg gctcacaaaa       300
     gtaatgcttt acgggtttga gttttcctta gctttaacct caatgcttgt aggttactta       360
     tattgtttta tgagacatcg ttag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page