(data stored in ACNUC7421 zone)

EMBL: CP001402.PE561

CP001402.PE561       Location/Qualifiers
FT   CDS_pept        complement(509837..510394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41197"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK0"
FT                   /protein_id="ACR41197.1"
FT                   /translation="MCLLVINNVARPIISDDVILLRDDSFSKVKDYLRVLSSDRRDGEI
FT                   SKSYFYFIVDRLRRMGLLIDNAIGFKAVLPFTVNNKGINLKEGIMYITNDRHLIYFNYY
FT                   DATYQCDRCSITTFSCVPSLKKIAHELDIKIRSDIPNIAWYELLEDIQYYLLESSIFLR
FT                   VKTTEIGKSSEVIKVGEYARDL"
     atgtgtctcc ttgtgatcaa caatgttgca aggccaataa tttcagatga cgttatatta        60
     cttagggatg acagtttcag caaggtaaaa gattacttaa gggttttaag cagtgatagg       120
     agggatgggg agatcagtaa gagttatttt tactttatcg tagataggct aaggagaatg       180
     gggttactaa ttgacaatgc aattggtttt aaggcagtac ttccctttac ggtaaataat       240
     aaagggataa atttgaagga ggggataatg tatatcacta atgatagaca tttgatatat       300
     ttcaactatt acgatgctac atatcagtgt gataggtgtt ctattacaac tttttcatgt       360
     gtcccatcat tgaagaaaat tgctcatgag ttagacatta aaataaggag tgatattccc       420
     aacatcgctt ggtatgagtt gttagaggac attcaatact atcttctcga gtcctctata       480
     tttttaagag taaagacgac tgaaattgga aagtcgtctg aggtgattaa agttggcgaa       540
     tatgcgagag atctataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page