(data stored in ACNUC7421 zone)

EMBL: CP001402.PE562

CP001402.PE562       Location/Qualifiers
FT   CDS_pept        complement(510816..511502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0574"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41198"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK1"
FT                   /protein_id="ACR41198.1"
FT                   /translation="MVKIGKVRIMELLEPEFFDTILNHNISVIENGPCGGLMIVDTGLP
FT                   GYLDQIESYLKTWGYSLEDISDIVITHWHHDHAGNAMTIKRISDAKIYAHVDELENLEN
FT                   PPKYNIIYSDELGVSFSIFKKTMERINNLHYESVKVDVALKGGEELGGFKVIHVPGHTK
FT                   GHIALFDGKYLIVGDAIRNVRNTLSPPLRIFSWNYDFAVNSFNYLVSLPYTVLIPYHGD
FT                   ITIKNL"
     atggttaaaa tcggtaaggt taggataatg gagttgttag agcctgaatt tttcgatacg        60
     atacttaatc acaatatatc cgttatagag aatggtcctt gtggggggtt aatgattgtt       120
     gatactggtt taccgggata ccttgatcag attgagtcct atcttaagac atggggatat       180
     tcgctagaag atatttcgga tatcgtaata acacattggc atcacgatca tgccggcaac       240
     gctatgacaa taaagagaat aagtgatgct aaaatatatg cccatgtgga tgagttagaa       300
     aatttggaaa atcctccaaa atataacata atttatagtg atgagttggg cgtttcgttt       360
     tcaatcttta agaagaccat ggagaggatt aacaatttgc attatgaatc agttaaggtt       420
     gatgttgcat taaaaggcgg tgaggagttg ggagggttta aggttataca tgtaccgggg       480
     catacaaagg ggcatattgc cttatttgat ggtaagtatt tgatagttgg tgatgctatt       540
     aggaatgtta gaaatacgtt atcaccaccc cttagaatat tctcttggaa ttacgacttt       600
     gccgtgaact cgtttaatta tttagtatcc cttccctata ctgtattgat accatatcac       660
     ggggatatca caattaagaa tttataa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page