(data stored in ACNUC7421 zone)

EMBL: CP001402.PE564

CP001402.PE564       Location/Qualifiers
FT   CDS_pept        513495..513809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0577"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41200"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK3"
FT                   /protein_id="ACR41200.1"
FT                   /translation="MYTKLGVYLVYSVGDRNESTFREVKKYLLDEGRWVSDDYNLYFWL
FT                   KGYTVVSPVNPNESLYSSSRDRLVRFKRATKAVNRSINLMKYSIALVLWEKRLIPEFVA
FT                   "
     gtgtacacga agttgggagt ttatctcgtc tactctgtgg gggataggaa tgagagtact        60
     tttcgcgagg tcaaaaagta tttgttggat gagggtaggt gggtgagcga tgattataat       120
     ttgtatttct ggttgaaagg ttacacggtt gtctcaccgg ttaaccctaa cgagtcactg       180
     tactcttcat cgagggatag gctggttagg ttcaagaggg ctactaaggc ggtaaatagg       240
     agcataaact taatgaagta ctccatagcc ctagtcttat gggaaaagag gttaatccca       300
     gaatttgtag cttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page