(data stored in ACNUC7421 zone)

EMBL: CP001402.PE566

CP001402.PE566       Location/Qualifiers
FT   CDS_pept        516899..517597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0580"
FT                   /product="protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41202"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK5"
FT                   /protein_id="ACR41202.1"
FT                   /translation="MPQYEILGKDLQYLKVMLGEGEAIYADAGHMVAKQSSVIMKTTMR
FT                   GGFFGALKREITGGSFFVTEFLGPGEVYLSGVFPGPIVQIQLQGNGILAESHSFLCAEN
FT                   NVNYDATLNRLGVGWLGGEGIFLARFRGDGNVFLHAYGGLIEKYLNPGESLQVEASHLM
FT                   AFEEGMRYGIQPVGGIRSLLFSGEGLFFVNIEGPGKIWLHTLTVEQLVASLRPYLPQGQ
FT                   QGGPGFNIRI"
     atgcctcagt atgaaattct tggaaaagat ttacagtact taaaagtaat gctaggtgaa        60
     ggagaagcaa tttacgctga tgcagggcat atggttgcaa aacaaagttc agtgataatg       120
     aagacgacaa tgaggggtgg attttttggt gctttaaaaa gggagataac tggcggatca       180
     tttttcgtaa ctgaattttt aggtccaggg gaagtatact tatctggagt ctttccaggt       240
     ccgatagttc aaatacaact acaaggcaat ggaattctag cagagtccca ttctttctta       300
     tgtgcagaaa acaatgtgaa ttacgatgct actttaaata gactaggtgt aggatggtta       360
     ggtggagaag gtatattttt agcaaggttt aggggtgatg gtaacgtatt cttgcacgct       420
     tacggaggtt taattgagaa ataccttaat cctggagaga gtttgcaagt tgaagcgtct       480
     catttaatgg catttgaaga aggtatgaga tatggtattc aacccgtagg aggaatacga       540
     tcactgttat tctctggaga gggtctattc tttgtaaata ttgaaggtcc aggaaaaata       600
     tggctacata cattgactgt tgaacaatta gtagcctcat taagaccata tttacctcaa       660
     ggtcagcaag gtggtccagg ctttaatatt aggatataa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page