(data stored in ACNUC7421 zone)

EMBL: CP001402.PE567

CP001402.PE567       Location/Qualifiers
FT   CDS_pept        complement(517934..518632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41203"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK6"
FT                   /protein_id="ACR41203.1"
FT                   /translation="MWKVPVLIQLLLILMEYINLKPRFYSKGTLAYALADYISGLSSWR
FT                   AVLPHSTLLYYHRRLSYVKYAVPLSGVYAIDETKVRLVKDKYYYVWIVRDVKTKPIPFF
FT                   MLTGVRSGVHILVVLVNMSRVEEITRRVFRTRVDKVVYLHDGATAYNAFSWFNVEHNKV
FT                   TFNEREYAEQGFRSLKHKLASMDFHFPWNSNKLTITRWLSTFFLMFNTLCTPTCLLDKE
FT                   VIINVNISNE"
     atgtggaaag ttcccgtgct catccaatta ctactaatac taatggagta tatcaatctt        60
     aagccaaggt tttactctaa gggtacctta gcctatgcct tggctgacta catttccgga       120
     ttatcctctt ggagggcagt gttaccccac tctaccttgc tctactacca taggaggttg       180
     agttatgtta agtacgctgt accattgagc ggggtttatg cgattgatga gactaaggtg       240
     aggctggtca aggacaagta ctattacgtg tggatcgtca gggacgttaa aaccaagcct       300
     atacctttct tcatgttaac gggtgttagg agtggagtac atattttggt agttttggtg       360
     aacatgagta gggttgagga aatcacaagg agggtgttta ggacgagggt agataaggta       420
     gtttatctgc atgacggagc aactgcatac aacgccttct catggtttaa cgtagaacac       480
     aacaaggtaa cgttcaacga gagggaatat gcggaacaag ggttcagaag cttgaaacac       540
     aagctggcat caatggactt ccacttccct tggaactcca ataagttaac aataacgagg       600
     tggttatcaa cattctttct aatgttcaac acgctttgca ccccgacatg tttattagac       660
     aaggaggtga taataaatgt aaatatttca aatgaatga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page