(data stored in ACNUC7421 zone)

EMBL: CP001402.PE573

CP001402.PE573       Location/Qualifiers
FT   CDS_pept        528590..528976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41209"
FT                   /db_xref="GOA:C4KEL2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL2"
FT                   /protein_id="ACR41209.1"
FT                   /translation="MNLFDNYKIFTISNVIMGLVFSALYFITTGFIQYYNLVYGILTLG
FT                   IAIWGIGRYYFKKIEDDKIRVGVQTSWLIVSFALGYISIIYAPVLFTRLEIIIIESILS
FT                   IIQILWGSVLLAISYRKGYSVIKV"
     atgaacttat ttgataacta taaaatattt actatatcca acgttataat gggattagtg        60
     tttagtgcac tgtatttcat tacaactggg tttatacaat actataactt agtttatggt       120
     atccttacgt tgggaatagc catatgggga attggaagat attatttcaa aaagatagaa       180
     gatgacaaaa taagagtagg agttcagaca tcatggctaa tagtctcttt cgctttaggt       240
     tacatatcaa taatttatgc ccctgttctg ttcactaggt tagaaataat aataattgaa       300
     tccattctat caataataca aattttgtgg ggttcagtct tattagcaat ttcatatagg       360
     aaaggatatt cagtcataaa ggtgtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page