(data stored in ACNUC7421 zone)

EMBL: CP001402.PE574

CP001402.PE574       Location/Qualifiers
FT   CDS_pept        528981..530063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0589"
FT                   /product="protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41210"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL3"
FT                   /protein_id="ACR41210.1"
FT                   /translation="METYFIQERDLQNLVTGASFLGTGGGGDPYIGGLMLKRELELVKK
FT                   IEVITGVKYSNSKSFVLGSAMMGAPIVMIEKIPSSSEAKKALEVYSKFSGNEVEYITPL
FT                   EMGGVNSTIPLITSAKTGIPVIDGDGMGRAFPELQMTTFYFYGVQPSPIVIFDERGNVS
FT                   IVQGIDGYWSEKIARVITVRYGGSAYIALYGTSLSTYSNTAVLGTLSLALEIGELLNQM
FT                   RLDDVLDLLKAMIVFKGKVVDVQRRVEKGFSKGNVIIDGIENIGEQTMKIDFQNEFLVA
FT                   RINNNIVTTVPDLITVLDLFTLKPITTDRIKYGQKVMVIGIPSSARLRSKEALRYIGPR
FT                   AFGYDVDFIPLEERWKKVEN"
     atggaaacgt atttcattca agagagagat ttacaaaact tagttactgg agcgtctttt        60
     ttaggtaccg gaggcggagg agatccatat ataggagggc ttatgttaaa aagggaatta       120
     gagcttgtaa aaaagataga agtaataact ggagtgaagt actcaaatag caaatccttc       180
     gttttaggta gtgcaatgat gggggctcct atagtgatga tagaaaaaat acccagtagc       240
     tctgaagcta aaaaggctct tgaagtttat tccaaatttt ccggtaatga ggttgaatac       300
     atcacaccat tggaaatggg tggagttaat tcaacgatcc cattaataac atcagctaag       360
     actggtattc cagtaattga tggagatggt atgggaaggg catttccaga attacaaatg       420
     actacctttt acttttatgg cgttcaacct tctccgatcg taatattcga tgaaagaggc       480
     aatgtaagca tagtacaagg tatagatggc tattggtctg agaaaatagc aagagttatt       540
     actgtaagat acggaggaag tgcatacatc gctctatatg gtacgtcatt atcaacttac       600
     tcaaatactg ctgtgctggg cacactgagt ttagccttag aaataggtga gctattaaat       660
     caaatgcgtc ttgatgatgt cttagacctt ttaaaggcaa tgatagtgtt caaaggtaag       720
     gtagtagatg tgcaaagaag agtagagaag ggattctcta aaggaaatgt aattatagat       780
     ggcatagaaa acatcggtga acaaactatg aagattgatt ttcaaaacga attcttagta       840
     gcgaggatta ataataacat agtaactact gtaccagatc tcataacagt tttagattta       900
     ttcacgttaa aacccattac gacagacaga ataaaatatg gtcaaaaagt catggttatc       960
     ggtatacctt caagcgctag actgaggagt aaggaagcgt taaggtatat aggacccaga      1020
     gcctttggat atgatgtgga tttcatacca ctcgaggaaa ggtggaagaa ggttgagaat      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page