(data stored in ACNUC7421 zone)

EMBL: CP001402.PE576

CP001402.PE576       Location/Qualifiers
FT   CDS_pept        complement(531569..532615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0591"
FT                   /product="protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41212"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL5"
FT                   /protein_id="ACR41212.1"
FT                   /translation="MKISVSDLYNLAIGSSILGSGGGGNPFLGYKIVKAKMLQMNIDYV
FT                   EYTDEIDEDRDFIIGVGGMGSPLIGIEKIPAGHEYYKSLMTLTKFLRKDVTKITSIEIG
FT                   GINSVVPFMASLMSKKPLVDGDYEGRAFPELYMTTMHFAGYKATPLSICDERENCVIID
FT                   AVDNFKAESIARSITVRFGGRGYISLYPASGREYINGAILGTVSLAFELGKTLTEEGLD
FT                   EMISLARGKIIFEGKIVDVKRFNLGGFAIGIAKIDGLKEYRGENAEVVFKNEYLSFLKE
FT                   EKILSISPEIINLIDYNNNVITSDSLRYGIKVRVLEIPVSNKWKEVGGYHKIKEMVFEE
FT                   IKKIRQLP"
     atgaaaattt ctgttagtga tctatacaat ctcgcaatag ggagttcaat attaggttct        60
     ggtggtggtg gaaatccgtt tttaggatat aaaattgtta aagcaaaaat gcttcagatg       120
     aatattgact atgttgaata tactgacgaa attgatgaag atagagattt cataatagga       180
     gtaggcggta tggggtcgcc attgataggt atagagaaga ttcccgcagg ccatgaatat       240
     tataaatctc ttatgacctt aactaaattt ttgagaaaag acgttactaa aataacttct       300
     attgaaatag gtggtataaa ctcagttgtc ccatttatgg catcgttaat gagtaagaaa       360
     ccattagtag atggagatta tgagggtaga gcttttccag aattatatat gactactatg       420
     cattttgcag gatataaggc aacacctttg agtatttgcg atgagcgtga aaattgcgtt       480
     attatagacg ctgttgataa cttcaaggca gagagcattg caaggagtat aactgtaaga       540
     tttggtggaa gaggatatat ctcgctttac ccagcatctg gtagggagta tattaacgga       600
     gctatcttgg gtacagtaag cctagctttc gagttaggta aaacattaac tgaagaagga       660
     ttggatgaaa tgattagctt ggcaagaggt aagataattt tcgaaggtaa aatagttgat       720
     gtaaagagat ttaacttagg aggatttgca attggtatag ctaaaattga cggccttaaa       780
     gaatataggg gtgaaaatgc cgaagtagta tttaaaaatg agtatttaag cttccttaaa       840
     gaagaaaaaa ttctatcaat atcacctgaa attatcaatt taatcgatta taataataat       900
     gtaattactt ctgactccct taggtacgga ataaaggtga gagtattaga aatccctgta       960
     agtaataagt ggaaagaagt tggtggatac cataagatta aggaaatggt atttgaagaa      1020
     attaagaaaa ttcgccaact accttaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page