(data stored in ACNUC7421 zone)

EMBL: CP001402.PE577

CP001402.PE577       Location/Qualifiers
FT   CDS_pept        533146..533490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0592"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41213"
FT                   /db_xref="GOA:C4KEL6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL6"
FT                   /protein_id="ACR41213.1"
FT                   /translation="MSVIEIKDIDSGLKEDRRGLKKLLDLAKRRQIDAVVVAYKDKLTR
FT                   FGFEYLVELFKAYGVNVVIAFQEEPKDYMQELVEDFVEIVKSFASRIYGHRSHKYEKVV
FT                   KCVEDVEKDS"
     gtgagtgtaa tagaaataaa ggatatagat tccggattga aagaggatag gagagggtta        60
     aagaaactct tagaccttgc taagaggaga cagatcgacg cagtagtagt ggcttataag       120
     gacaagctaa cgcgtttcgg atttgagtac cttgttgagt tattcaaagc ttacggagta       180
     aatgttgtca tagcgttcca agaagagcca aaggattaca tgcaagagtt ggttgaggac       240
     ttcgttgaaa tcgttaaatc attcgcctca agaatttacg gtcatagatc tcacaaatac       300
     gagaaggtgg taaaatgtgt tgaagacgtt gaaaaggaca gttag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page