(data stored in ACNUC7421 zone)

EMBL: CP001402.PE579

CP001402.PE579       Location/Qualifiers
FT   CDS_pept        535128..535832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0594"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41215"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL8"
FT                   /protein_id="ACR41215.1"
FT                   /translation="MSLFNLSLVIFEIDHEDCWSKLTSSYPVLVKTIFAKPNKGKDYIL
FT                   GMDEVKTYTRRTFKDFLKSFKRDKSIYEIIQILELDNRRGIYRILFKERYENMIMSIIG
FT                   NYMTFYVKDLIKEGNERLLLIMPSSDVTMLKRDLESIGKIHYFNSKLVNFNDFVPTFFD
FT                   LSEQERNAVLQAIRLGYYEYPRRINLEELGKIMGISKPTLEEYLRKAEKKIMSKIFREF
FT                   YQQDLLFHSPDY"
     gtgtcactat ttaacttatc actagtaatt tttgaaatag atcatgagga ttgttggagt        60
     aagcttacgt caagttaccc tgtactagta aaaaccattt ttgcgaagcc gaataaggga       120
     aaagattata ttttaggaat ggacgaagtt aaaacatata ccagaagaac ttttaaggac       180
     ttcttaaagt cgttcaagag agataagagt atttacgaga ttatacaaat cttagagttg       240
     gacaatagga ggggaattta taggatatta tttaaagaaa ggtacgagaa catgatcatg       300
     agtatcatag gaaattatat gacgttctat gtaaaagact tgataaaaga aggtaatgaa       360
     agattattac taattatgcc ttcaagtgac gttacaatgc ttaagaggga tttggaatcc       420
     atagggaaga tccattactt taattctaaa cttgtaaact ttaatgactt cgtacctaca       480
     ttctttgatc tttctgagca agaaaggaat gctgtgcttc aggccataag actaggatat       540
     tatgaatatc ctagaagaat aaacctagag gaattaggga agattatggg aatatcaaaa       600
     cccacattgg aggaatattt aaggaaagcc gaaaagaaga ttatgtctaa aatatttagg       660
     gagttttacc aacaagatct actctttcac tctccagatt attaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page