(data stored in ACNUC7421 zone)

EMBL: CP001402.PE581

CP001402.PE581       Location/Qualifiers
FT   CDS_pept        complement(537331..538449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0596"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41217"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM0"
FT                   /protein_id="ACR41217.1"
FT                   /translation="MTVKIDKIYVISTESISRQNFPYAKPTDYYREYLGSLSPFQSAFM
FT                   DKICFIRMDLDDNATYSILETSESVCNFIMSNLANLVKDLPISRISMAWDLLYRYTLPI
FT                   GRSGIAIHAISVVNLLMYDAYAKLLGVPVYELLGGKTRDKIRAYASHLHPTSKEELEKE
FT                   AGSYVEEGYTAMKMRFCCGPSDPLGVDNNAELVKVIRDSVGYSVDLAGDAWMSWNLNFA
FT                   LKMARRLEKYELCWIEEPFLPDDFESYSYLSKRTDIPISAGEHHYHVYDFKRLLDSGVR
FT                   ILQPDAVWVGGITPMKRITGLAEAYGSVVIPHTSNIYNLHFIISEPESVSPMAEYLTKY
FT                   KWLEDRVINPPKPIKGYFELGEEKGFGLKYDL"
     atgacggtaa aaattgataa gatatatgta attagtacgg agagtatttc aagacagaac        60
     tttccttacg ctaagccaac tgattattac agagagtatt tgggatcttt atcaccattt       120
     caatcagcgt tcatggataa gatttgtttt ataagaatgg atctagacga taacgctact       180
     tattccattc ttgaaacctc tgaatcagta tgtaatttca taatgtctaa tttagctaac       240
     cttgttaagg atctaccaat ctctaggata agtatggcgt gggatttgtt atatagatac       300
     accctgccaa ttggtaggag tgggatagca attcacgcca taagtgttgt taatctttta       360
     atgtacgacg cgtatgcaaa gttactagga gttccagttt acgaactgtt aggaggaaaa       420
     acaagggata agataagggc ttacgcaagt cacttacatc ccacaagtaa ggaggagttg       480
     gaaaaggagg ctgggagtta tgtggaagag ggatatactg cgatgaagat gaggttctgc       540
     tgtggtccct ctgatccttt aggcgttgac aataatgccg aattggtaaa agttataagg       600
     gacagtgttg gttattctgt ggatttagct ggagacgcgt ggatgtcttg gaatttgaat       660
     ttcgcattaa agatggctag gagattggag aaatatgagt tgtgttggat tgaggaaccc       720
     ttcttaccgg atgatttcga gtcttatagt tacttaagta aaagaacaga tattccaata       780
     tctgctggtg aacatcacta tcacgtttac gatttcaaga ggcttttgga ttccggagtg       840
     agaatattac agcccgatgc cgtatgggtt ggagggataa ctccaatgaa gagaattact       900
     ggattggctg aagcttatgg tagtgttgta atccctcata cttctaacat atacaatttg       960
     cactttataa tatcagaacc agaaagtgtt tcgccaatgg ctgagtactt aaccaaatat      1020
     aaatggctag aggatagagt gataaatcct cctaagccaa taaagggata tttcgaattg      1080
     ggagaagaaa aaggttttgg cttaaagtat gacctttaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page