(data stored in ACNUC7421 zone)

EMBL: CP001402.PE582

CP001402.PE582       Location/Qualifiers
FT   CDS_pept        538577..539656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0597"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41218"
FT                   /db_xref="GOA:C4KEM1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM1"
FT                   /protein_id="ACR41218.1"
FT                   /translation="MFGITFYSAMRKNISMVKSKAALLKKFSEPLSIEDVEIPEPKGEE
FT                   VLVRIGGAGVCRTDLRVWKGVEAKQGFRLPIILGHENAGTVVEVGELAKAKKGDNVVVY
FT                   ATWGDMTCRYCREGKFNICKNQVIPGQTTNGGFSEYMLVKSYRWLVKLDSLSPVDASPL
FT                   ADAGTTSMGAIRQALPFMNKFAEPVVIVNGIGGLAVYTIQILKALMKNIVIVGISRSRK
FT                   HRDLALELGADYAVEMKEAESLISKLTDGLGASVAIDLVGTEETSYNLGKLLAQEGAII
FT                   LVGMEGKRVSLEAFDTAVWNKKLLGSNYGSLNDLEDVVRLSESGKIKPYVVKIPLDEIN
FT                   KAFKDLDEGRVEGRQVITP"
     atgtttggaa tcacctttta ttcggcgatg aggaaaaaca taagtatggt taaatcaaaa        60
     gcagcccttc tgaagaagtt ctcagaacca ttatcgatag aagacgttga aattcctgaa       120
     ccaaaggggg aagaggtttt agtaagaata ggaggagctg gagtctgcag aaccgatttg       180
     agagtatgga aaggagttga agcgaaacaa ggtttcagat taccaataat attgggccat       240
     gaaaatgccg ggacagtagt agaagttggg gaattggcaa aggcaaagaa gggagataac       300
     gttgtggttt acgcaacttg gggtgacatg acttgcagat attgcagaga ggggaagttt       360
     aacatttgca aaaatcaagt gatccctggg caaacaacaa atggcggttt ctcagagtac       420
     atgttagtta aaagttatag atggttagtg aaattagaca gcctaagccc agttgatgca       480
     tcaccattag cagatgctgg tactacttct atgggagcta taaggcaagc cttaccgttt       540
     atgaacaaat tcgcagaacc agttgtgata gttaacggta ttggagggtt agccgtttac       600
     accatccaaa tattaaaggc gctaatgaag aatatagtta tagttggaat ttctaggagt       660
     agaaagcata gggatttggc gttagagttg ggagcggatt acgcggttga aatgaaagaa       720
     gctgaaagtt taataagcaa actcacagat ggcttaggtg ccagtgttgc aatagattta       780
     gtgggaacag aggaaacttc ttataattta ggaaagttgt tagcacaaga gggtgcaata       840
     atactagtgg gtatggaggg gaagagggtt agtttagagg cctttgatac tgcggtatgg       900
     aataagaagc ttctgggttc caattacggt tcactaaacg atttagaaga tgttgtaaga       960
     cttagcgaaa gtgggaaaat taagccatat gttgttaaaa tacctttaga tgaaataaac      1020
     aaggccttta aggatttaga tgagggaaga gtagagggaa gacaagtaat aacaccttag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page