(data stored in ACNUC7421 zone)

EMBL: CP001402.PE583

CP001402.PE583       Location/Qualifiers
FT   CDS_pept        540526..540885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41219"
FT                   /db_xref="GOA:C4KEM2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM2"
FT                   /protein_id="ACR41219.1"
FT                   /translation="MRLDLRRREEKKIASIKNWTLIYGRRKTGKTTLVKSALKYDTYII
FT                   IGDVNNAITQSDEIVRIEKALEEVKRTLKNGGIAVIDEFQRLPEIYWSLIASWAPSGIL
FT                   VAIGSSYGILTSSPP"
     gtgagactag atctcagaag acgagaagag aagaagattg ccagcataaa gaactggacg        60
     ctaatttatg gtaggagaaa aacaggcaaa actacattag ttaagagtgc attgaaatac       120
     gacacttata ttataatagg agacgtaaat aacgcaataa ctcaaagcga tgaaatagta       180
     agaattgaaa aggcattgga agaggtaaag agaactctaa agaatggagg aatagcggta       240
     attgacgaat tccaaagatt gccagagata tattggtctc taattgccag ttgggcgcct       300
     tctggtatat tggtagctat tggctcaagt tacgggattc tgacctcctc cccgccctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page