(data stored in ACNUC7421 zone)

EMBL: CP001402.PE585

CP001402.PE585       Location/Qualifiers
FT   CDS_pept        complement(542173..542583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0601"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41221"
FT                   /db_xref="GOA:C4KEM4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM4"
FT                   /protein_id="ACR41221.1"
FT                   /translation="MEYKSTRHAKYLCNYHFVWIPKYRRDLLIDEVAEYTKEVLKSIAE
FT                   ELGCEIITLEVMPDHIHLFVNCPPRYSPSYLANYFKGKSARLVLKKFPELRKHTGGKLW
FT                   TRNYFISTAGNVSSETIKKYIEEQWEKEDEEN"
     gtggaataca aatcaacgag gcatgcgaaa tacctatgca actaccattt cgtatggatt        60
     cctaagtatc gtagagattt attaatcgac gaagtagctg aatacactaa agaggtgcta       120
     aaatcaatcg ccgaagaatt aggatgtgaa ataataaccc tagaagtaat gccagaccac       180
     atacacctct tcgtaaactg cccacccaga tactcgccct catacctagc aaactacttc       240
     aagggaaaat cagctagact agtcttgaag aaattcccag agctaagaaa acatactgga       300
     ggaaaactct ggactagaaa ctacttcata tcaacagctg gtaacgtatc gagtgaaacc       360
     ataaagaaat acattgagga acagtgggag aaagaggatg aagagaacta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page