(data stored in ACNUC7421 zone)

EMBL: CP001402.PE59

CP001402.PE59        Location/Qualifiers
FT   CDS_pept        49697..50182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40695"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH5"
FT                   /protein_id="ACR40695.1"
FT                   /translation="MQNFREISIDIVLSHRIRNYDQIILEGSRKRDSCAFFIYGYCKKI
FT                   SSKSKVLASWISNGKIVPHPLFCYLCPFYSLRDDDKTVTIDLFDIYLTYKNLKTQIERE
FT                   LEFIESRLSEFSFSTSIALRRRREDLIAFLDDISTKIKILMEIIRVSEREHEDGRYI"
     atgcagaact ttagggaaat atcaattgat atagttcttt cgcataggat acggaactat        60
     gaccaaataa ttcttgaggg cagtagaaaa cgtgattcgt gcgcgttttt catttatggc       120
     tattgtaaaa aaatttcgtc aaaaagtaaa gttcttgcta gctggatatc taatggaaag       180
     attgttcctc atcccttatt ctgctattta tgtccatttt actcgttaag agacgatgat       240
     aaaaccgtaa ctattgatct tttcgatatt tacttaacat ataaaaattt aaagacacaa       300
     attgaaaggg aattagaatt tatagagagc agactttcag agttttcgtt ttccacttcc       360
     atagctctga ggaggaggag ggaggacttg atagctttcc ttgatgatat ctcaactaaa       420
     attaaaatac tcatggaaat aataagggta agtgagagag agcatgagga cggaagatat       480
     atttaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page