(data stored in ACNUC7421 zone)

EMBL: CP001402.PE597

CP001402.PE597       Location/Qualifiers
FT   CDS_pept        complement(553114..553521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0614"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41233"
FT                   /db_xref="GOA:C4KEN6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN6"
FT                   /protein_id="ACR41233.1"
FT                   /translation="MRYRLDRESHSVYALYYHYVQVVKYRRKVFDNEDIINFLKEKIQE
FT                   ISKTFEVEVIDIGVDKDHFHMLFKAKPTLNIPKYINTIKTITSREIQRRFPQVKEKLWK
FT                   GHFWSPSYFLATSGQVTLEVLKKYVESQGKE"
     atgcggtaca gattggacag agaatcccat tcagtttacg ctctttatta tcactatgtc        60
     caagtggtga agtaccgcag gaaggtgttc gataatgagg atattatcaa cttcttgaag       120
     gaaaaaattc aggaaataag caaaacattc gaagttgaag tcatagatat aggagtagat       180
     aaggatcact tccacatgtt attcaaagcg aaaccaacct tgaatatacc caagtatata       240
     aacactatca aaactatcac ctctagggaa atacagagaa ggttcccaca agtcaaggaa       300
     aaactatgga agggacactt ctggtctcct tcttatttcc tagcaacaag cggacaagta       360
     acattggagg tactgaaaaa atatgtggag agccaaggaa aagaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page