(data stored in ACNUC7421 zone)

EMBL: CP001402.PE598

CP001402.PE598       Location/Qualifiers
FT   CDS_pept        complement(553670..554026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41234"
FT                   /db_xref="GOA:C4KEN7"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN7"
FT                   /protein_id="ACR41234.1"
FT                   /translation="MGLIYIDGIVKNERGESEKVRFLIDSGAYYTVLKKEVWQKLGLKE
FT                   ISHVSLILADGTTIERGVSEAIIELPPYGERHSPIILGESEDENLLGVVTLEIFGLVLD
FT                   PLKREIRQGRIIMK"
     atgggtttaa tttacattga tgggatagtg aaaaatgaac gtggagaaag tgaaaaagtt        60
     aggttcttaa ttgactctgg tgcttattat actgttctaa agaaggaagt atggcaaaaa       120
     ttgggcttaa aggagatttc tcacgtatca ctaatcttag ctgatggtac aactatagag       180
     aggggagttt ctgaagccat aatagaatta ccaccttatg gtgaaagaca ctcaccaata       240
     atcttaggtg agagtgagga cgagaattta ttaggcgtag taactctcga aatctttgga       300
     ttagtcctag accctttaaa gagggagata agacaaggta ggataataat gaagtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page