(data stored in ACNUC7421 zone)

EMBL: CP001402.PE599

CP001402.PE599       Location/Qualifiers
FT   CDS_pept        complement(554570..555256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41235"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN8"
FT                   /protein_id="ACR41235.1"
FT                   /translation="MVVKEIIHKHLSYTSIPEFFDGEYWPSQIWYCLRKQYYSRVSPIP
FT                   MSLESKKFTTLGTIIHEFIAETLKKEESVRVESEVPIRIPHPNRHNVVISGRADDIIIV
FT                   TVGKSRYVVEVKTIDDLESKRSYLPRNEHIAQLNVYLRAYPNSKGIILYVDRGSFEMEE
FT                   FEISFNPDLFNETIKRVEMLHDYLIKRELPPPEAKENQDMKWQCDICEYRAKCEKQISS
FT                   NSNRKF"
     atggtagtta aggaaattat tcacaagcat ttaagttata cttctattcc agagttcttt        60
     gatggcgaat attggccatc ccagatatgg tattgtttaa gaaagcagta ctattctaga       120
     gtttctccta ttcccatgtc cttagaaagt aagaagttta caacactggg aactataatc       180
     catgaattta tagcggaaac gctcaagaaa gaggaatccg taagggttga gtctgaagta       240
     cccataagga taccacatcc aaataggcat aatgtagtga tttctggtag agctgacgat       300
     attataatag taacagttgg aaagtcgaga tatgttgtcg aggttaaaac tattgacgat       360
     ttagagagta agaggtctta tttacccaga aacgagcata tagcccagct taacgtatat       420
     ttaagggctt accctaactc taaggggatt atcctttatg tggatagggg aagttttgaa       480
     atggaggagt ttgaaatttc ctttaaccca gatctcttta acgagacaat taagagggtt       540
     gaaatgcttc atgattacct cataaaaagg gaattgccac caccagaggc taaggagaat       600
     caggatatga aatggcaatg cgatatttgt gaatataggg ctaaatgtga gaagcaaata       660
     agcagtaaca gtaataggaa gttctaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page