(data stored in ACNUC7421 zone)

EMBL: CP001402.PE600

CP001402.PE600       Location/Qualifiers
FT   CDS_pept        complement(555634..555924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0617"
FT                   /product="conserved hypothetical PepK protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN9"
FT                   /protein_id="ACR41236.1"
FT                   /translation="MDCEKLEKKVDGVLSILKELKGKERTTQDLDRVYDFVKDNLCMAS
FT                   IKDIREQLGMTLEEFMAKFRDYIIRNYELISGGKEGIVKEGVLYGIIRRKR"
     atggattgcg aaaagttgga gaaaaaggtt gatggggtgt taagcattct taaggaattg        60
     aaggggaaag agagaactac acaagacctt gacagagttt acgatttcgt taaggacaat       120
     ctttgcatgg cgtcgattaa ggacataaga gaacaactcg gtatgacact ggaggaattc       180
     atggctaaat tccgtgatta tataatcaga aattatgaac taatcagtgg cggaaaggaa       240
     gggattgtaa aggaaggtgt attatacggc ataataagac gcaagagata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page