(data stored in ACNUC7421 zone)

EMBL: CP001402.PE602

CP001402.PE602       Location/Qualifiers
FT   CDS_pept        complement(556170..556346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41238"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP1"
FT                   /protein_id="ACR41238.1"
FT                   /translation="MMISHTDVGNAQKGEGDYGDVSSMPLGSKESHDPPIRWLRAKYLH
FT                   SIMNEHKMSEMKV"
     atgatgatct ctcacaccga tgtgggcaat gcccaaaagg gtgagggaga ttacggagat        60
     gtgagctcca tgccgttggg ctctaaggag tcccatgatc cacctataag gtggttgagg       120
     gctaagtacc tacactcgat catgaatgaa cataaaatga gtgaaatgaa agtgtag          177
//

If you have problems or comments...

PBIL Back to PBIL home page