(data stored in ACNUC7421 zone)

EMBL: CP001402.PE603

CP001402.PE603       Location/Qualifiers
FT   CDS_pept        complement(556667..557020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41239"
FT                   /db_xref="GOA:C4KEP2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP2"
FT                   /protein_id="ACR41239.1"
FT                   /translation="MELIDRIKLLMRNKELRLIYTVYPIPVTEIELSVITPLIFQSDLA
FT                   NRNIFIASIIISLLSYVPLIRQSISFIVHHIKRIREARISFMLSFFIISAFESFLFMNR
FT                   ITLLSAILILTCI"
     ttggagctta tcgataggat taaattgctg atgaggaaca aagagctaag gcttatatat        60
     actgtttacc caatccccgt gacagagata gaattgtctg taataactcc gttaattttt       120
     caaagtgatc ttgctaatag gaatatattt atcgcgtcca taattatctc cctcctatct       180
     tacgttcctt tgattaggca atccatctca tttattgtac atcacataaa gagaataagg       240
     gaggcaagga tctcgttcat gctctccttt ttcataatct cagcctttga atctttctta       300
     ttcatgaaca gaataaccct tctatccgcc atattaattc tcacttgtat ataa             354
//

If you have problems or comments...

PBIL Back to PBIL home page