(data stored in ACNUC7421 zone)

EMBL: CP001402.PE604

CP001402.PE604       Location/Qualifiers
FT   CDS_pept        557633..557887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0621"
FT                   /product="Protein of unknown function DUF217"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41240"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP3"
FT                   /protein_id="ACR41240.1"
FT                   /translation="MYIGYMKTIMIRDEVYRKLVEIKGDKSFSDLIEELIEESLSLRRK
FT                   KLEKYFGILSEEEAEELEREIKEMRKRSDESINRKLSNY"
     atgtatatag gatatatgaa aacaataatg ataagggatg aggtatacag aaagttggtt        60
     gagataaagg gtgataagag cttcagcgat ttaattgagg agttaataga ggaatcgtta       120
     agtttgagga ggaaaaagtt ggagaaatat tttggcatac taagtgaaga ggaggctgaa       180
     gaactggaga gagaaattaa ggaaatgagg aagaggagtg atgaaagtat taatagaaag       240
     ctcagcaatt attga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page