(data stored in ACNUC7421 zone)

EMBL: CP001402.PE608

CP001402.PE608       Location/Qualifiers
FT   CDS_pept        complement(559579..560106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0625"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41244"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP7"
FT                   /protein_id="ACR41244.1"
FT                   /translation="MEGYLDYKNNSKGYIYAKLYDSLVEGKLALEMLQKGLLQNASSKA
FT                   FLSVKSAISALVVKNLNEIIKLKNEKEKYWYENVGYSAPTTGLIGISKDLKNLSIDAEN
FT                   AIRIALSLHKFSYNGFDPNFVDYRNSEEVISDIKEVIEWLLNLKYYFSDFWDEKLEKAK
FT                   KELEELLKNTFN"
     atggaaggat atttagatta taaaaataat tctaaaggtt atatttacgc taaattatac        60
     gatagtttag ttgaaggtaa attagcttta gagatgttac aaaaaggtct gttacagaac       120
     gcttcttcaa aggcattttt aagtgtaaaa tctgctatta gcgcactagt tgtaaagaat       180
     cttaatgaga ttatcaaatt aaaaaatgag aaggaaaagt attggtacga gaacgtcgga       240
     tattcagcac ctacaacggg attaatagga atatcaaaag acttaaaaaa cttaagcata       300
     gacgctgaga acgcgataag aattgctcta tctttacaca agttctcgta caatggtttt       360
     gatcctaatt ttgtcgatta taggaactct gaagaggtaa taagtgacat aaaagaggtc       420
     atagagtggt tacttaattt aaaatattac tttagcgatt tttgggacga aaaattagaa       480
     aaagcaaaga aggagttaga ggaattatta aaaaatacgt tcaattaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page