(data stored in ACNUC7421 zone)

EMBL: CP001402.PE609

CP001402.PE609       Location/Qualifiers
FT   CDS_pept        complement(560307..560912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41245"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP8"
FT                   /protein_id="ACR41245.1"
FT                   /translation="MAISCDRIFVEGATEKIILSKLGFNEDNIEVKFGKEEVIKEFKKY
FT                   LSSSMSILKKGNVCFVIDGDEEGYKGVYDRLKKDISVLDYSPPYIKMCKDNLCYVLVVI
FT                   GNKNDDFKGCIETILLEKLKIDEKINDVIHRVLEYEQQKVGHLSMCDRDKIRFYLSIFL
FT                   LSGEPTLLYLSKRFTEELFRIVGEDVIRNIIADFIEIK"
     atggctataa gttgtgatag aatatttgta gaaggtgcta ctgaaaagat cattcttagt        60
     aagctaggtt ttaatgaaga taatatagaa gtaaagtttg ggaaggaaga ggtgattaag       120
     gaatttaaaa agtacttgtc ttcctctatg tctatcttga aaaagggaaa tgtatgtttt       180
     gtaatagatg gagacgagga aggatataaa ggtgtttatg atagacttaa gaaggatata       240
     agcgtactag attattctcc accgtatata aaaatgtgta aggataactt atgttatgtt       300
     ttagtagtca taggtaataa aaatgatgat tttaaaggtt gtattgaaac aatattattg       360
     gaaaaactca agatagacga gaaaattaat gatgtaatac acagagtatt agaatatgag       420
     caacagaagg taggtcatct ttcaatgtgc gatagagata aaatacgttt ttatttatcg       480
     atatttttac tttctggaga accaacattg ctttatctat ctaaaaggtt tacagaagaa       540
     ttatttagaa tagttggaga ggatgtcata agaaatatta tcgctgattt catagaaatt       600
     aaatag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page