(data stored in ACNUC7421 zone)

EMBL: CP001402.PE610

CP001402.PE610       Location/Qualifiers
FT   CDS_pept        complement(560918..561817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41246"
FT                   /db_xref="GOA:C4KEP9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP9"
FT                   /protein_id="ACR41246.1"
FT                   /translation="MNISEVNVEGFRGLKIATRLKRINIVVGENGSGKTSFLESIFMST
FT                   LFQSDINDNDIYTFLIYILNSRGDILSAFSTLSDSKVRLDGVITQFKKIDPYSIDVEIN
FT                   NEKVVEIRVKSGILTTETLSGPLFLPIVRIIKRVNIKYSPLYISTFFDSSGNPERIYSI
FT                   AKRKNRKIESNFEILQDEYGQFKLYYDRLPAYVMGRGLLKRELIKLALMSSDILLIDEI
FT                   EDSLHPDLVMEVLNDIKNEKGVQVIFTTHVNEVVKMAGKVLDDSEAQVIYLSKVGYKTY
FT                   KLSEISEFEKPLSWLGYV"
     atgaatataa gtgaggtcaa tgtagagggt tttagggggc ttaaaattgc tactaggctt        60
     aagaggatta atattgtcgt tggggagaac ggtagcggta agacttcttt tcttgaatca       120
     atttttatgt caactctttt ccaatcagat ataaatgata atgacatata cacttttctc       180
     atttatatac taaacagtag gggagatatt ctttctgcct tttccactct gtctgactct       240
     aaagttagac ttgacggtgt aataacacaa tttaagaaga ttgaccctta cagtattgat       300
     gttgaaataa ataatgaaaa agtagttgaa attagagtaa aatctggaat cttaacaact       360
     gagactttat ctggaccgtt gtttttgcca attgtaagga ttataaaaag ggtcaatatt       420
     aaatattccc ctctttatat ttctacattc tttgattcct cagggaatcc agaaagaatt       480
     tacagtatcg caaaaagaaa aaatagaaaa atagaatcca attttgaaat attacaagac       540
     gaatatggtc aatttaagct atattatgat aggctacctg cctacgttat gggcagagga       600
     ctcttaaaga gggaattaat aaaactagcc ctaatgtcat ctgacattct cttaatcgat       660
     gaaattgaag attcccttca tcccgatctt gtaatggaag tattgaatga tataaagaat       720
     gaaaaaggag ttcaagtaat tttcactact cacgtaaatg aagttgtaaa aatggcggga       780
     aaagtacttg acgattctga agctcaagta atttatctat ctaaagtagg atataaaacg       840
     tataagcttt cagaaatttc tgaattcgag aagcccctta gttggttagg atacgtgtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page