(data stored in ACNUC7421 zone)

EMBL: CP001402.PE611

CP001402.PE611       Location/Qualifiers
FT   CDS_pept        562396..562854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0628"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41247"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ0"
FT                   /protein_id="ACR41247.1"
FT                   /translation="MNMLIMSVNNNSKYILGILKIAKELNIQVTATRIQKTVFLVEKEL
FT                   KLDLGYNFIPFYFGPFSKELQDDIYKLSELGYVKIREEPVEDLISGVIVGFKKIYEINV
FT                   TFDLSSLDKNFVDFVTEKLKMPLNSLLKYVYMKYPEYTVNSLIKDKIF"
     atgaatatgt taatcatgag tgttaacaat aatagtaaat acattttagg catactgaag        60
     atcgctaagg aattgaatat ccaagtaacg gctacaagaa tacaaaaaac tgttttctta       120
     gttgagaagg aattaaagct tgacttaggc tataatttca ttccctttta tttcgggcct       180
     ttcagtaaag agttgcaaga cgacatatac aagctcagtg agttaggtta tgtgaaaatt       240
     agggaagagc cagttgaaga tctcatttca ggcgttatag ttggctttaa gaagatttat       300
     gaaataaacg taacttttga cttaagttca ctagataaaa actttgtcga tttcgttact       360
     gaaaagctta agatgcccct caatagtctg cttaaatacg tttatatgaa atatccagaa       420
     tacactgtga actcattaat taaagataag attttttag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page