(data stored in ACNUC7421 zone)

EMBL: CP001402.PE614

CP001402.PE614       Location/Qualifiers
FT   CDS_pept        565697..566971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41250"
FT                   /db_xref="GOA:C4KEQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ3"
FT                   /protein_id="ACR41250.1"
FT                   /translation="MSKGIKTSVRVYKIDYMSSNNKKINERDLALLKKVGKYYLQYKGI
FT                   IDLDKLLSIIEATEELNIDNITRIYIIQYIIYLAVKAAVRAAKEAEKDRLTYKEFSIGY
FT                   DQDIFGELNIDRTTIVYPQGLYAYYTYTEGYNAPEYGILGYLLRRIYDTAIDKFVEIKL
FT                   HHYFNFTEKMKKFMKKLEEIKEKFPEGYYRNSTYTDPQWLIRAFRAYEIMKKLENIGIG
FT                   LKRSKTEIKRPLIKFILWKLYELYIFYLIVNYLKKKGYRIKRKGDKNYLAFKDGIYFTI
FT                   IFNSNLENSRLLRVNNYPNLEKFKGKPDISLDHNSGDKNNIIIIECKYSDRLSYISMGR
FT                   FKIMAYVYEYNPLTAILVYPGLKEGQLLYDDEDKATKELDDYVKKNNYVKFEFKNHELY
FT                   MARINPKAEDEKNLKTIDEILGKYI"
     gtgtcaaaag ggataaaaac cagtgttcgg gtatataaaa tagattatat gagtagtaat        60
     aataaaaaga taaacgaaag agatttagca ttacttaaaa aagttggcaa gtattatttg       120
     caatacaaag gtattataga tctagataag ctgctttcca taattgaagc tacggaagaa       180
     ttaaatatag ataatattac taggatttat ataattcaat atattatata tcttgctgtt       240
     aaagctgcag ttagggcagc taaagaggcc gaaaaagaca gactaactta taaggagttc       300
     tcaataggat atgatcaaga tatatttgga gaactaaata ttgataggac aacaattgtt       360
     tatcctcaag ggctttacgc atattatacc tatacagaag gatataatgc accagaatat       420
     ggaattttag gttacttatt aagaagaatc tacgacactg caatagataa gtttgtggag       480
     ataaaattac accattattt taactttaca gaaaaaatga aaaaatttat gaagaaatta       540
     gaggaaataa aagaaaagtt tcctgaggga tattatagaa attctacgta cactgaccct       600
     caatggctca taagagcttt tagggcttat gagattatga agaaattaga aaatatagga       660
     ataggattaa aaagaagtaa aacagaaata aagagacccc ttatcaaatt tatattatgg       720
     aaattatatg agctttatat tttttatctc atagtaaatt accttaagaa aaaaggatat       780
     aggattaaaa gaaaggggga taaaaattat ttagcgttta aagatgggat ttatttcact       840
     ataattttca actcaaatct tgaaaactct agactattga gggtaaataa ttaccctaat       900
     ttagagaaat ttaagggaaa acctgatatt tccttagatc acaattctgg agataaaaat       960
     aatattatca taattgagtg caaatactca gataggctaa gttacattag tatgggtcgt      1020
     tttaaaataa tggcttacgt atatgaatat aatccattaa ctgcaatttt agtatatcct      1080
     ggattaaaag aagggcaact attatatgac gatgaggata aagcaacaaa ggaattagat      1140
     gattacgtaa agaaaaataa ctacgttaaa tttgaattta aaaatcatga actttatatg      1200
     gctagaatta atcctaaagc tgaagatgag aaaaacctta agactatcga tgaaatttta      1260
     ggaaagtaca tttaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page