(data stored in ACNUC7421 zone)

EMBL: CP001402.PE616

CP001402.PE616       Location/Qualifiers
FT   CDS_pept        569806..570096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41252"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ5"
FT                   /protein_id="ACR41252.1"
FT                   /translation="MHKKRSSIEVIVSILEACNKGDIKKTRIMFITYLNPRSFYRYIEI
FT                   LKSKGFISLNTDETYELTPKGYDYLNKAKEYLEIKRKLQILKKELDFNSQN"
     atgcataaaa aaagaagtag tatcgaagta atagttagta tattagaagc gtgtaacaag        60
     ggtgacatta agaagacgag aataatgttt attacgtatt taaatcctag atctttctac       120
     agatatatag aaatattaaa gagtaaagga tttatatctc ttaacaccga tgagacgtac       180
     gagctaactc caaaaggata tgattattta aataaagcta aagagtatct agaaataaaa       240
     cgcaaattac agatcctgaa gaaagaattg gattttaata gtcaaaatta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page