(data stored in ACNUC7421 zone)

EMBL: CP001402.PE62

CP001402.PE62        Location/Qualifiers
FT   CDS_pept        complement(51911..52930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40698"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH8"
FT                   /protein_id="ACR40698.1"
FT                   /translation="MIRKIYDKLAESHNEIKNQIYNIASYLRQEIQEKVNEFWTEYTRD
FT                   NELSEICKFVAIDGGSFSKPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDA
FT                   QERISLLMEALELSLALRDGSKGDYILMDGSLNKKIGNKVDIQQISDEELKLVKNVDIN
FT                   SIISIKDERKMRDLLMLLNQFLVSRIIEQYDGKVLWISKTSRGRDLFGTDYPDITVFEL
FT                   FTEKRGFSKLIIKNIDIRKISEIPELEILRKMEYTTFYTRLDNGKRVVRIDMVGRVDEK
FT                   IVKEIMDHLSGVSIKGYPFPLLKAHIDVRFSRMDREKIIKLMGSKLHKDIEWWPSQFY"
     ttgataagaa aaatatatga taagttagcg gaaagtcaca acgagataaa aaatcagatt        60
     tacaatattg ctagctacct taggcaagaa atacaagaaa aggttaatga gttttggact       120
     gaatacacta gagataatga gttaagcgaa atatgcaaat ttgtagctat tgatggtggc       180
     tctttcagta aacctatgag aatagggata gtttatgctg taggagctga atccgtaatc       240
     ggagataata aaggagtaaa gacattgagc gaggatggtc aaataggtat attcaagcca       300
     gggaacgatg cacaagaaag aatatcacta ttaatggagg cattggaatt atcactagct       360
     ttaagggatg gtagtaaagg agattacatt cttatggatg gaagtttaaa caaaaagatt       420
     ggtaataaag tcgatattca acaaatctct gatgaagagc taaagctagt taagaatgtc       480
     gacataaata gtattattag cataaaagat gaaaggaaaa tgagggattt gctaatgcta       540
     ctaaatcaat tcctcgttag tagaataata gagcaatatg atggcaaggt tttatggata       600
     tctaaaacca gtagggggag agatttattt ggtacagact atcccgacat aactgttttt       660
     gaactgttta ctgaaaaaag aggattttca aaacttataa tcaaaaatat agacatcaga       720
     aaaatttctg agatacccga gcttgagata ttaagaaaaa tggaatatac gactttctat       780
     actagattgg ataatggtaa gagggttgtt agaatagata tggttggaag agtggatgag       840
     aaaatagtaa aggagataat ggatcatttg agtggagtaa gcattaaggg atatccattt       900
     ccactcttaa aagctcatat agacgttaga ttttcaagga tggataggga aaaaataata       960
     aagttaatgg gaagtaaact tcacaaagat attgagtggt ggcccagcca gttttattaa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page