(data stored in ACNUC7421 zone)

EMBL: CP001402.PE621

CP001402.PE621       Location/Qualifiers
FT   CDS_pept        complement(574996..575442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41257"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER0"
FT                   /protein_id="ACR41257.1"
FT                   /translation="MKVKIIYDDGKEEEIEPKKVEVTSSNDNKNYAHYKYTKMEDSKII
FT                   IFHVYLVTNEKPSVILPKIEEEVKSKTSKIVGYKNIADDLIARARITQLQQQVQTCIYC
FT                   GEIATNQYAGKTVCSSCFNYLVKYGEDSTEFRKYLNRKLLDKWK"
     atgaaagtta aaataattta tgatgatgga aaggaagaag aaattgaacc taaaaaagta        60
     gaagttacaa gtagtaatga taataaaaat tatgcacatt ataaatatac aaagatggaa       120
     gatagtaaaa taatcatttt tcatgtttat ttagtgacaa acgaaaaacc ttcggttata       180
     ctccctaaaa tagaagaaga ggtaaaatct aaaacatcta agatagtcgg ttataaaaat       240
     atagcagatg acttaatagc tagagccaga ataactcaat tgcagcaaca agtacagact       300
     tgcatatatt gtggagaaat tgctacaaat cagtatgctg gtaaaactgt ctgttcgtca       360
     tgttttaatt atttagttaa gtatggagaa gatagtactg aatttagaaa atatttaaat       420
     agaaaattat tagataaatg gaaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page