(data stored in ACNUC7421 zone)

EMBL: CP001402.PE622

CP001402.PE622       Location/Qualifiers
FT   CDS_pept        complement(575462..576916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41258"
FT                   /db_xref="GOA:C4KER1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER1"
FT                   /protein_id="ACR41258.1"
FT                   /translation="MPIIISDHMDPDVDFYVPPGSDATQALQEALQLSLVYGVAHIIIR
FT                   GRLYVYASSQVTLLLDQSLHYIFEGDGLGEIIYVNPNNLSSVPPLVAIGSISTVEMQYI
FT                   TNNNGVANKQEAGYSTWGWIIAFKNMRLINLTPQRWLIITGMPYHMHSIMFYFDSVQFF
FT                   ANIWLNQTGTVLLYNCYANNAELLFDTQSRELMAIGCRFENGSNLAISPRGWTVVGCVF
FT                   VGTNITYLNPGTDGNNGSVVGCVFDGATIVTQGADNLKIVATQFQNVTFNGGSVQLTQG
FT                   INYGIVGCSFVNYNVVISDLYRGHTIFIAFNNFDDGSNLVILIRDNYVVDSITILGNLF
FT                   SSIPTHNSFIFIAGSPSPGQSLQLSGTVNMLYVAFNTFINSSHTSGAAYGYELANNYRI
FT                   HAFAYINVAISIIYAYIAFNYFQQNYGLYNNSTGKPIGFFSLQQLTTNVKTVQNLFFYF
FT                   NVNENNPMYIPSSQAYTAQFNIGIKQ"
     atgcctataa taatttcaga tcacatggat cctgatgttg atttttacgt tcctccaggt        60
     agtgatgcaa cacaagcttt acaggaagct ttacaactgt ccttagttta cggagtcgct       120
     catattataa ttagaggtcg actttatgtt tacgcttcat cgcaagtaac tttattacta       180
     gatcaatctc ttcattatat attcgaaggt gacggactag gagaaattat atatgtaaat       240
     cctaataact tatctagtgt tcctccttta gttgcaatag gctcaataag tacggttgaa       300
     atgcagtata taacgaacaa caacggagta gcaaataagc aggaagctgg ttattctaca       360
     tggggttgga taattgcctt taagaacatg agattaatta atttaactcc acagagatgg       420
     cttattatta ctggaatgcc atatcatatg cactcaatta tgttttactt cgatagtgta       480
     cagttctttg ctaacatatg gttaaaccaa acaggtactg tgctcttata taattgttat       540
     gctaataatg cagagttatt gtttgatacg caatcaaggg aactaatggc gataggttgt       600
     agatttgaaa acggtagtaa tttagcaatc tcacccaggg gttggactgt tgttggctgt       660
     gtatttgtag gcactaacat aacctattta aatcctggaa ctgatggtaa taatggttct       720
     gttgttggct gtgtatttga tggagcaact atagttactc aaggtgcaga taatctaaaa       780
     atagttgcaa cacaatttca aaatgttaca tttaatggtg gcagtgtaca gctgacacaa       840
     ggtataaatt atgggatagt aggatgttca tttgttaact ataatgttgt tatatctgat       900
     ttatatagag gtcatactat atttatagcc tttaataatt ttgatgatgg atcgaattta       960
     gtaatcctga taagggataa ctatgtagta gattccataa ctatattagg aaatctgttc      1020
     tcttcaattc caacacataa ttcctttata tttattgctg gctcaccttc acccggtcaa      1080
     tcattacaat taagcggcac tgtaaatatg ctttacgttg cttttaatac tttcattaat      1140
     tcctctcata cttctggagc agcttatggt tatgagttag caaataatta tagaattcat      1200
     gccttcgcat atattaatgt tgcaataagc ataatttatg cttacatagc ctttaactat      1260
     ttccagcaaa actatgggtt atataataat agtacgggca aaccaatagg ctttttcagt      1320
     ttacagcaac tcactactaa tgttaaaaca gtgcagaatc tattcttcta ttttaatgtg      1380
     aatgaaaata atccaatgta tataccgtct tcacaagctt atactgcgca atttaatata      1440
     gggattaaac aataa                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page