(data stored in ACNUC7421 zone)

EMBL: CP001402.PE623

CP001402.PE623       Location/Qualifiers
FT   CDS_pept        complement(576919..578079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41259"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER2"
FT                   /protein_id="ACR41259.1"
FT                   /translation="MIDVSEGNSSVNLDRRKFLFLTSSAILFSTPATLLITAKDRKEIA
FT                   KAQTSSSSIYPYIAIVEGDPSNGYNVLTDSGVIFNGSCTDGSGTCGIYEAIQYLQNNYG
FT                   QGEVVLLGKFYPIKSPITSPPNNIEITGSGMICINPGSAPMFISLLPIISNEIKILWYT
FT                   NTGIINKILTKRRSFSLLPYVLFTGTIQSLLFANGDQALGTPSQFTISAWIFGKPSGYT
FT                   GYILSYGSLEDGEAWGIRASSNDIIFEGTTGSISAPFPSNIPFHLVVTYNNGQAAIYIN
FT                   GNQVASGSISVNYPNRAYLWINNFPIHSQQGGLNLGSWYSIIENIQFYTTVLSSSQIST
FT                   LSSSIAQDPVTIPVFWSLYRYLMYLGDLITGIGFQRMGALFYGGVT"
     atgattgatg tgagtgaagg aaatagctca gttaatttag accgaaggaa atttcttttt        60
     ctaacatcct cagcaatttt atttagtact cctgctactt tattaattac agctaaagat       120
     aggaaggaaa tagctaaagc gcaaacttca tcatcatcta tctatcctta tatcgcaatt       180
     gtagaaggtg atcctagtaa tggatataat gttttaacag attctggtgt aatctttaac       240
     ggaagctgta cagatggttc tggtacatgc ggaatatatg aggctattca atatctgcaa       300
     aataattacg gtcaagggga agtagttctt cttggaaaat tttatccaat aaaatcccct       360
     ataacttctc cgcctaataa cattgaaatt actggaagcg gaatgatttg tataaatcct       420
     ggtagtgctc ctatgtttat ttctcttttg ccaataatta gtaatgaaat taaaatactt       480
     tggtatacta atactggtat tatcaataaa attttaacca agagaaggtc attttcttta       540
     ctgccttatg tattatttac aggaactatt caatcactcc tatttgctaa tggtgatcaa       600
     gctttaggta ccccttcaca attcactatt tcagcatgga tttttggtaa acctagcgga       660
     tatactggat atatattgtc ttatggttcg ttagaagatg gagaagcatg gggtataaga       720
     gcaagtagta atgatataat attcgaaggt actaccggtt cgatatctgc accttttcca       780
     tcaaatattc ccttccattt agtggtaaca tataataatg gtcaagcagc aatttatatt       840
     aacggcaatc aagtagcatc ggggtcaata agtgtaaatt atcctaatcg cgcatattta       900
     tggataaata atttccctat tcatagccaa caaggtggac ttaatttagg atcttggtat       960
     tctataatag agaatataca attctatact acggttctat catcctccca gatttcgacc      1020
     ctttcctcgt ccatagcaca agatccggta actataccag ttttctggag tttatataga      1080
     tatttaatgt atttaggcga tttaattact ggaataggtt tccaaagaat gggagcttta      1140
     ttttatggtg gggtgactta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page