(data stored in ACNUC7421 zone)

EMBL: CP001402.PE624

CP001402.PE624       Location/Qualifiers
FT   CDS_pept        complement(578584..579267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41260"
FT                   /db_xref="GOA:C4KER3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER3"
FT                   /protein_id="ACR41260.1"
FT                   /translation="MNYLWFYIIVLGLGLLVINLFVISYPPFTIFSLGLISTGIAAYGV
FT                   NIGHKKDDKVELLMDSLYRNLELIFRYYNSDSYYRIFIPSSIGSNGILLLDKFPVRIEN
FT                   VKEELINKFNDGIGIFLETPGSIIVKEMRKKGINFSEDLEFLLRKALVELYNFGDNVEV
FT                   NFNYEKSVNVKIHNPDPNKAYSIIGYIQTLIVASIIAEKTSKITYVKSENRSLSILNID
FT                   IGILE"
     atgaactatc tatggtttta tataatagtt ttaggactag gcttattagt aataaatctc        60
     ttcgttattt cttatccccc atttacaatc ttttcattag gtttaatttc gactggtatt       120
     gcagcttatg gtgtgaatat aggacataaa aaggatgaca aagtagaatt actaatggat       180
     agtttatata gaaatcttga attaattttc agatattata atagtgatag ttattataga       240
     atatttattc catcatctat tggttccaac ggaatattac tacttgacaa gtttccagta       300
     cgtatagaga atgttaaaga agagctaata aataaattta atgatggtat aggcattttt       360
     ttagaaactc cagggagtat aatagttaaa gaaatgagaa agaaaggaat taatttctcc       420
     gaagatttgg agtttctttt aaggaaggct ctagtcgaat tatataattt tggagataac       480
     gtagaggtaa attttaatta tgaaaaatca gtaaatgtaa agattcataa tccagatcct       540
     aataaggctt atagtataat aggatatata caaacattaa tagtagcttc gataatagcg       600
     gaaaaaacat caaaaataac ttatgtgaaa tcggaaaata gatcattaag catattaaat       660
     atagatattg gcatcttaga ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page