(data stored in ACNUC7421 zone)

EMBL: CP001402.PE63

CP001402.PE63        Location/Qualifiers
FT   CDS_pept        complement(52927..55521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0063"
FT                   /product="Rad50 zinc hook domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40699"
FT                   /db_xref="GOA:C4KJH9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH9"
FT                   /protein_id="ACR40699.1"
FT                   /translation="MRIDKITLTNFLSHEHSEIHFLGEINVIVGQNGAGKSSIIDGIVF
FT                   SLFRTHSRGNNDNLIRKGSNKASVTLHLSNEKDKIEIIRDIRSTTEDRLIRNQIPVARS
FT                   ATVVSNEIEKILGIDKDIALSTIIVRQGELDKILENLQDIMGKILKLESIEKLIDSRGP
FT                   IVEFKKNLENKLRELDKIEQDYNDSKKNLEEKRNRVLELEKDRKKLEDEIKNLENQITE
FT                   LKKQFEDYEKKRNQYLELTTILKVKETKLNELNKSIEELRRQTENMDKLEKEVNELDNL
FT                   KNFRLKFEKYEVLSRSYIEISNNILNLEKEIEEYEKAIKRKKELEPHYLRYKELERKLE
FT                   ELQPKHEEYLKSKSNLDSKLNLKERLEKDASEFSKDIDRISNLEQIMEEKRKRQLDLRA
FT                   QLGKVESLISEKNEIINNLSQVKGETCPVCGRPLDEEHKQKIVEEAKSYISRLELDKNE
FT                   LEEELKKTTDELNKIEKEYRKLSNNKANYDNVIKQLRKLNEEIENLHNRIEALKDIEEE
FT                   IKKINVEIKDLKQYYEEFMRLFKYDEKELERKKNRLDEMNKKKVEIEKEMRALETELQG
FT                   LDRKELENKISDLERKKKILDEMKKKRGVLEDYIGQVELLQEDVKKLREKLNIIQFDEN
FT                   KYNELKTSLDVHNASLKEKENRKSRVEGELDSLGKDIEEISNRIKNYELQLKDKEKIIN
FT                   GINKLEKIRDALGERKLQSYIIMATKQLIENNLNDIISKFDLSIKNVEMEIMPKTSRGK
FT                   GSGGNIVIYTNNGDTLPIVSLSGGERIALSIALRLAIAKALMSNTNFFILDEPTIHLDD
FT                   QRKAYLIEIIRAAKESVPQILVVTHDEEVVQAADYVIRVEKRGNKSFVREET"
     atgagaattg acaaaattac tttgactaat tttttaagtc atgaacacag tgaaatacac        60
     tttctaggcg aaataaatgt aatagtggga caaaatggag caggtaagag ttctataata       120
     gatggcatag tattcagttt gtttagaacc catagtagag gaaataacga caacttaata       180
     agaaaaggtt caaataaggc gagcgttacc ttacatcttt ctaatgaaaa agataaaata       240
     gaaataataa gggatataag aagcactaca gaagataggt taatacggaa tcaaatacca       300
     gttgcacgta gtgcaacggt agtctctaat gaaatagaga aaattctggg tattgataaa       360
     gatattgccc tatcaacaat aatagttaga caaggagaat tggataaaat tttggagaat       420
     ttacaagaca ttatggggaa aattctaaag ttggaatcaa tcgagaagct tattgatagc       480
     agaggtccaa tagtggaatt taagaagaat ttggaaaaca agttaagaga gttagacaag       540
     atagaacaag actataatga ttctaagaaa aacttggagg agaagagaaa tagagtgttg       600
     gagttagaaa aagataggaa aaaactggag gatgagataa agaacttgga aaatcaaata       660
     actgagttaa agaaacaatt cgaagattat gagaagaaaa gaaatcagta cttagagttg       720
     accactatct taaaggtaaa agaaactaaa ttaaatgaat taaacaagag tatagaagaa       780
     ctaagaagac aaacggaaaa catggataag ctagaaaagg aggtaaacga acttgacaat       840
     ttaaagaatt ttagattaaa atttgaaaaa tatgaagttt tatcgagaag ttatatagag       900
     atatccaata atatacttaa tttagaaaag gaaattgagg aatatgaaaa agctattaaa       960
     agaaagaaag aacttgagcc acattatcta agatacaagg aattggagag aaaactggaa      1020
     gaattacagc caaaacatga agaatatctc aaatcgaaat ccaatttaga ctccaaacta      1080
     aatttaaaag aacgtttaga gaaagacgca agtgagtttt ctaaagatat agatagaatt      1140
     agtaatcttg aacaaattat ggaagagaaa agaaaaagac aacttgatct tcgagctcaa      1200
     ttaggtaaag ttgaaagcct aatatctgag aaaaatgaga taataaataa tcttagtcaa      1260
     gttaaggggg aaacttgtcc ggtatgtgga agacccctag atgaggaaca caaacaaaaa      1320
     atagtagaag aagcaaaaag ttacatttca cgattagaat tagataagaa tgaactggaa      1380
     gaagaattaa agaaaaccac tgatgaatta aataaaattg aaaaagaata tagaaaactc      1440
     tcaaataata aggcaaatta cgataatgta ataaagcaac ttagaaagtt aaacgaggaa      1500
     atagagaatc ttcataatag gattgaagct ttaaaggata tagaggagga aattaagaaa      1560
     ataaatgtag aaataaagga cctaaaacag tattatgaag agtttatgag actatttaag      1620
     tatgacgaga aggaacttga aagaaaaaaa aataggttag atgaaatgaa caagaaaaaa      1680
     gtagaaatcg aaaaagaaat gagggctcta gaaaccgaat tacaagggtt agaccgtaaa      1740
     gagctggaga ataaaatttc agatttagag aggaagaaaa aaatcttgga tgaaatgaag      1800
     aagaaaagag gagtactaga agactatata ggacaagttg agctactaca agaagatgtt      1860
     aagaaactaa gggaaaaatt aaatataata cagtttgatg aaaataaata taatgaactt      1920
     aaaacgagtt tagatgtcca taatgccagt cttaaggaga aggaaaacag aaaaagtaga      1980
     gtggagggcg aattggatag tttaggtaaa gacatagagg aaataagtaa tcgaattaag      2040
     aattatgaat tgcaactaaa agataaagaa aagataatca atggtattaa taagctggag      2100
     aaaattagag atgcattagg agaacgaaaa ttacagagtt atataatcat ggcaacaaaa      2160
     caattaattg aaaataatct aaatgatata atatcgaaat ttgatctatc tattaaaaac      2220
     gtagaaatgg agataatgcc aaaaactagt agaggaaagg gtagtggtgg gaatatagta      2280
     atatacacta ataacggcga tactttgccc atagtatcgc ttagtggagg tgagagaatt      2340
     gccttatcta tagctttaag gttagcaata gctaaggcac tgatgagtaa tactaacttc      2400
     ttcattcttg acgagccaac aattcattta gatgatcaaa gaaaagcgta cttaatagag      2460
     ataattaggg cagcaaagga aagtgtacct cagatattag tggtaacaca tgacgaggag      2520
     gtagtccagg cagctgatta tgttattcgt gttgaaaaga gaggaaataa aagttttgtg      2580
     agggaggaga cttga                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page