(data stored in ACNUC7421 zone)

EMBL: CP001402.PE630

CP001402.PE630       Location/Qualifiers
FT   CDS_pept        complement(585990..586463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41266"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER9"
FT                   /protein_id="ACR41266.1"
FT                   /translation="MNNIDRKLEELGIINVNTAFHSLGEKIVIGVDKAQGNIISILEDD
FT                   DLFLSNKIEKILKMFNNYNIGYYHNSYVHIDTKQRILGYPIKLNKPLLLIQQRDKQKYV
FT                   DKLIFKYYSIYNNNSISTDKSIIIKNKNYIKNFTYALDIFYFMPILQAIKDIF"
     atgaataata tagatagaaa attagaagaa ttaggaataa taaatgtaaa tacagctttc        60
     cattcgttag gagaaaaaat agttattggc gtagataaag ctcaaggtaa tataatatca       120
     attttagaag atgatgactt gtttttatct aataaaatag agaaaatttt aaaaatgttt       180
     aataattaca atataggtta ttatcataat agttatgttc atatagatac gaaacagaga       240
     atattagggt atcctattaa gcttaataag ccattactac ttattcagca aagagataaa       300
     caaaaatacg tagataagtt gatttttaaa tattattcta tatataataa taattctatt       360
     tcaacagata agtctattat aattaaaaat aaaaattata ttaaaaattt tacttatgct       420
     ctagatattt tttattttat gccgatattg caagcgataa aggatatatt ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page