(data stored in ACNUC7421 zone)

EMBL: CP001402.PE638

CP001402.PE638       Location/Qualifiers
FT   CDS_pept        596085..596747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41274"
FT                   /db_xref="GOA:C4KF58"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF58"
FT                   /protein_id="ACR41274.1"
FT                   /translation="MVEVSQLITQYKMIYSQYLLSLELYRIETYSLLVLPLMVFAIYYF
FT                   FGKKLKYYYYLIWYKVNKKKKTVSLKSGKDPISNGILVGIVIILLLFGFGIYTLNIQPK
FT                   ENFSEMVILNSNGIIGNYPSHLVPGENALIYVLVQNHEGMPMLYQIKVILNNNNTNITL
FT                   YTSYNIVNNNGEWKLPIAFAINSTGTFKLEVMLYYYNLTLQRFIYTNIFNQLVVSVS"
     atggttgagg tttcgcagtt aataactcaa tataagatga tatactcgca atatctttta        60
     agcttggaat tatataggat agaaacttat tcattattag ttttaccatt aatggttttt       120
     gctatctatt attttttcgg aaaaaaacta aaatactatt attatctaat atggtataaa       180
     gttaataaaa agaaaaaaac tgtatcatta aaaagtggaa aagatcctat aagtaatggt       240
     atattagttg gaattgttat aattttacta ttatttggat ttggaatata tacattaaat       300
     attcagccca aggaaaattt ctcagaaatg gttatcttaa attctaatgg cattattgga       360
     aattatccat cacatctagt tcctggagaa aatgcactaa tttatgtttt agtccaaaat       420
     catgaaggta tgccaatgct ttatcaaatt aaagtgattt taaataataa caatactaat       480
     ataactctat atacatccta taatatagtt aacaataatg gcgaatggaa attacctata       540
     gctttcgcta taaattctac tggaactttt aaattggaag taatgttgta ttactacaac       600
     ttaactttac agaggtttat atatacaaat atctttaacc agttagtagt tagtgtaagt       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page