(data stored in ACNUC7421 zone)

EMBL: CP001402.PE639

CP001402.PE639       Location/Qualifiers
FT   CDS_pept        596749..597228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41275"
FT                   /db_xref="GOA:C4KF59"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF59"
FT                   /protein_id="ACR41275.1"
FT                   /translation="MMIMQKREVETSKTVEQMVNELVNKGYSEIEAIKIIHDKYEIENK
FT                   LDFTSIIIHISSLILILSLFNSSSFIISLKIALGIFYSIFFVGYAALRIFYPKELKQLS
FT                   SLHTLGISLATSFAIIAMIGLLLNFTIGITIYTGIIGIVILTETFNIIYNLRGYR"
     atgatgatta tgcaaaaaag ggaagtagag acaagtaaaa ccgtcgaaca aatggtaaat        60
     gaacttgtaa ataaaggata tagtgaaatt gaagcaatta agataataca tgataaatac       120
     gagatagaga ataaattaga tttcactagc ataattattc atatatcatc attaatcttg       180
     atattatctc tattcaattc ttcaagtttc attatatcat taaaaatagc tttaggcata       240
     ttttactcaa tattttttgt aggatatgct gcattgcgaa tattttatcc aaaagagtta       300
     aaacaactat ctagtttaca tactttaggt atttcgttag caacaagttt tgctataata       360
     gctatgatag gtctgttatt aaactttact ataggtatta ctatatatac aggaataata       420
     ggcatagtaa tcttaaccga aacgtttaat ataatatata atttaagggg atatagatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page