(data stored in ACNUC7421 zone)

EMBL: CP001402.PE640

CP001402.PE640       Location/Qualifiers
FT   CDS_pept        597225..597467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41276"
FT                   /db_xref="GOA:C4KF60"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF60"
FT                   /protein_id="ACR41276.1"
FT                   /translation="MNYKTFPIILGLEYTLISTVLSVLNLTDIKAYIILFAIASVITEI
FT                   IYYPLSKRTNYVISAITVFWVILSIYFILQIFGVT"
     atgaattata agacattccc tattatttta ggattagaat atacgttaat ctcaacagtt        60
     ttgtctgtac tcaatttaac cgatattaaa gcatatatca ttttatttgc tatagcatct       120
     gtaataacag aaattatata ttatccttta tctaaaagaa caaattacgt tatttctgct       180
     attaccgtgt tctgggtaat attgagcatc tactttattt tacaaatatt tggtgtgaca       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page