(data stored in ACNUC7421 zone)

EMBL: CP001402.PE645

CP001402.PE645       Location/Qualifiers
FT   CDS_pept        603578..605371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41281"
FT                   /db_xref="GOA:C4KF65"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF65"
FT                   /protein_id="ACR41281.1"
FT                   /translation="MDNVVIYLGIIVAGFLIGILSNIILKRNSLLKSFYIVSVAAINLI
FT                   ILSLILITSLLMRTNLSNTLILLSLLFLSIFFSFYINTYRNILSDINVSAFGLITIVIL
FT                   LLAISPFYISTDRNISYLPFYVTNPKISTSPLFQDYIKILGNPSYYNVYRPNPILSRSL
FT                   EIYSNMVYNLLGNFINQSLSIRNFSNYIYVSLHSGNTSGAIQYYSELLETFDNLTIIKN
FT                   NITYYASILGEYSDSLSFGQFLHILNKNYTEIKNIVNNYYIIMSFIYKLPKTSHVPVEI
FT                   KITKLIIPFNKTVNITGFLISRSNYSINGTLFVKFLNTYRVVNLTNSRFSFPIRLTNYS
FT                   NPIYITILFTGNNIFLPNITTFVVYTNVTFTKLFVKAIPYNPYVGGDVNIVGYVTGYNR
FT                   TLVISLLNYTKTYIVGGNFSIKFPLPYNLTNTTYLLNFTVLPKSYLSPAVKYIVITPKL
FT                   YYENLSVNVIDKWIIPFPLKITGKIYYNNTPLNNVKIFVFIGNSRYETISHNGYFSIEA
FT                   KPKLSVIYGNQIIYVESDPQYAYYREVAEVHTTVYNFMMFIILPLISLFIVILLRKRSK
FT                   ANKLKQFKLKEIPIQGVKNEK"
     gtggataatg tagtaatata tcttgggata atagttgcag gtttcttaat aggcatacta        60
     tccaatatta tactaaaaag aaattcccta ttaaagtcat tctatatagt atctgttgca       120
     gctattaact tgattatatt atcattaatt ttaattacat cgttattaat gagaaccaat       180
     ttaagtaata cacttatact tctatcactc ttatttctct caatattctt ttcattttat       240
     ataaacactt ataggaatat attaagtgat ataaatgttt ccgcatttgg actaattacg       300
     atagttattc tattattagc tatatctccc ttttatattt cgacagatag aaatatatca       360
     tatttaccat tttatgtaac taatccaaaa atctctacat ctcccttatt ccaagattat       420
     ataaaaatct taggtaaccc ttcttactat aatgtatatc gtcctaatcc gattttatcg       480
     aggagtttgg aaatatattc gaacatggta tataatttat taggcaactt tattaatcag       540
     tcactaagta tcagaaattt ttctaattac atatacgtct cattacattc tggaaatact       600
     agtggagcta tacaatatta ttctgaatta ttagaaacat ttgataatct tacaattata       660
     aaaaataata tcacatatta cgcaagcatt ttaggtgagt actcagatag tttaagtttt       720
     ggacaatttc tacatatatt aaataaaaat tataccgaaa ttaaaaatat agttaataat       780
     tattatatca taatgagttt tatttataaa ctacccaaaa cctcccatgt accagtagaa       840
     ataaagatta ccaagttaat aattccgttt aataagacgg taaatataac tggatttctt       900
     atttcacgtt ctaactattc gataaatggt actttatttg taaaatttct taatacctat       960
     agggttgtta atttaactaa tagtagattc tctttcccaa ttcgcttaac taattacagt      1020
     aatcctattt acataactat attatttacg ggaaataata ttttcttacc aaatataaca      1080
     acattcgtgg tatataccaa tgtgacgttt actaaactat ttgttaaggc aataccatac      1140
     aatccgtatg taggaggtga tgtgaatata gtaggatatg ttactgggta taatagaacg      1200
     cttgtaattt ctttgttaaa ctatactaaa acatatatag ttggcggtaa ctttagtatt      1260
     aaattccctc taccttataa tctaactaat actacatatc tcttaaattt taccgtctta      1320
     cctaagagtt atttatctcc agctgttaaa tatatagtta ttactcctaa attatactat      1380
     gaaaatctta gcgttaatgt tatagataaa tggataattc cttttccatt aaaaataacc      1440
     ggaaagatat attataataa tacacctcta aacaatgtga aaattttcgt cttcattgga      1500
     aactctagat atgaaactat ttcgcataat ggatattttt ctattgaagc aaagcctaag      1560
     cttagcgtta tatatggaaa tcaaataata tatgtggaat ctgaccctca atatgcttat      1620
     tatagagaag tagccgaagt tcatactaca gtgtataact ttatgatgtt cattatatta      1680
     cctttgattt cattatttat agtcatattg cttagaaaaa gatctaaagc aaataagctt      1740
     aaacaattca aattaaagga gattccaata caaggtgtaa aaaatgaaaa ataa            1794
//

If you have problems or comments...

PBIL Back to PBIL home page