(data stored in ACNUC7421 zone)

EMBL: CP001402.PE646

CP001402.PE646       Location/Qualifiers
FT   CDS_pept        605361..606014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41282"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF66"
FT                   /protein_id="ACR41282.1"
FT                   /translation="MKNKVSIVLPICILLLLPIIFPDTYPFSPFNIGSQGISYFYNNFE
FT                   NITSSNVTILILMENINNVTPYLIYLLEGNTIIITGNYSNVNNFLHKLNADVIIAPIVL
FT                   TNNLDYYMNNKIIIINESNYTLIFPYAHPIIGGIPLVEVDNNSIIAYYHYGSGKIIIIS
FT                   TPYFFLNSYYKLFNNSEYLHEITGTNKIRIVIYTQVSPLSEFKEFLQSLKSLHL"
     atgaaaaata aggtatcaat agttttgcca atatgcatat tacttttact tccgataatt        60
     ttcccagaca cctatccttt ttcccctttt aatataggga gtcagggtat atcttatttc       120
     tataataatt ttgagaatat tacttcatct aacgttacta tcttaatatt aatggagaat       180
     atcaataacg ttactcctta tttaatctat ttacttgaag gaaacacaat tattataact       240
     ggaaattata gtaatgtaaa caattttctg cataagttaa atgcagacgt tattatagct       300
     ccaatagttt taacgaataa tttagattat tatatgaata acaagataat aataataaat       360
     gaaagtaatt atacattaat atttccttac gcacatccaa ttatcggagg aataccctta       420
     gtagaagtag ataataatag cattatagct tattatcact atggatcagg aaaaattata       480
     attatatcta ctccatattt ctttttaaat agttattata aattgtttaa taattctgag       540
     tatctacatg aaataactgg cacaaataag ataagaatcg tcatatatac tcaagtctct       600
     ccattgtcag aatttaagga atttttacaa tctcttaaat ctttacattt ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page